DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and cbx4

DIOPT Version :9

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_991312.1 Gene:cbx4 / 573110 ZFINID:ZDB-GENE-040329-2 Length:477 Species:Danio rerio


Alignment Length:80 Identity:18/80 - (22%)
Similarity:35/80 - (43%) Gaps:20/80 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GLEPLRILGACNWSGKLTFLMQWKGCDEA--GLVPAEVLNVRCPQMVISFYEERIVFTDEGDEED 85
            |:|..|:.     .|::.:|::|:|....  ...|.|  |:..|:::::|.          :.|.
Zfish    15 GIEKKRLR-----KGRMEYLVKWRGWSPKYNTWEPEE--NILDPRLLVAFQ----------NRER 62

  Fly    86 LESDNGY-ETTPSPR 99
            .|...|| :..|.|:
Zfish    63 QEQMVGYRKRGPKPK 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 11/52 (21%)
cbx4NP_991312.1 Chromo 13..60 CDD:278797 12/61 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.