DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HP6 and rhi

DIOPT Version :9

Sequence 1:	NP_608842.1	Gene:	HP6 / 33661	FlyBaseID:	FBgn0031613	Length:	106	Species:	Drosophila melanogaster
Sequence 2:	NP_536794.1	Gene:	rhi / 44879	FlyBaseID:	FBgn0004400	Length:	418	Species:	Drosophila melanogaster

Alignment Length:	59	Identity:	16/59 - (27%)
Similarity:	26/59 - (44%)	Gaps:	1/59 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    19 GFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISFYEE-RIV 76
            |.:.||:..:||.....:..|...:.||||.....|....:....|..:|.::|. ||:
  Fly   357 GVNRGLDLDKILHCYQMNDDLFMFVTWKGCSSIDAVHINDIKEAYPLQIIKYFESLRII 415

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HP6	NP_608842.1	Chromo_shadow	25..76	CDD:279701	12/51 (24%)
rhi	NP_536794.1	CHROMO	22..72	CDD:237991
rhi	NP_536794.1	ChSh	357..411	CDD:294039	13/53 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1911
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR22812
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	5	4.920