DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and HP1c

DIOPT Version :9

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster


Alignment Length:79 Identity:25/79 - (31%)
Similarity:45/79 - (56%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKQRNGFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISF------YE 72
            :::..|::.|||...|:||.:.:|.:.:|::|:.|||..|||:..:..:.|||:|.:      |.
  Fly    75 IQKLRGYERGLELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQKMAPYS 139

  Fly    73 ERIVFTDEGDEEDL 86
            ..|....:|..|:|
  Fly   140 RHIAMRMKGVPEEL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 18/56 (32%)
HP1cNP_651093.1 Chromo 9..58 CDD:278797
Chromo_shadow 89..134 CDD:279701 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.