DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and cbx1b

DIOPT Version :9

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001002090.1 Gene:cbx1b / 415180 ZFINID:ZDB-GENE-040625-68 Length:203 Species:Danio rerio


Alignment Length:78 Identity:43/78 - (55%)
Similarity:56/78 - (71%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PVKQRNGFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISFYEERIVF 77
            |.|.| ||..||:|.||:||.:.||:|.|||:||..|||.||||:..||:|||:||||||||:.:
Zfish   125 PEKLR-GFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTW 188

  Fly    78 TDEGDEEDLESDN 90
            .....||:.:.|:
Zfish   189 HSYPTEEEEKKDD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 33/50 (66%)
cbx1bNP_001002090.1 Chromo 54..97 CDD:278797
Chromo_shadow 136..187 CDD:279701 33/50 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.