powered by:
Protein Alignment HP6 and Oxp
DIOPT Version :9
Sequence 1: | NP_608842.1 |
Gene: | HP6 / 33661 |
FlyBaseID: | FBgn0031613 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611240.1 |
Gene: | Oxp / 37002 |
FlyBaseID: | FBgn0034255 |
Length: | 84 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 15/71 - (21%) |
Similarity: | 27/71 - (38%) |
Gaps: | 15/71 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 RNGFDLGLEPLRI------------LGACNWSGKLTFLMQWKG--CDEAGLVPAEVLNVRCPQMV 67
:...||||....: ||.....|:..:|.:|:| .::....|.|.|. :|..::
Fly 3 QKSIDLGLGVRNVKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLG-KCMTLI 66
Fly 68 ISFYEE 73
..:..|
Fly 67 ADYEAE 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1911 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000191 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.