DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and Oxp

DIOPT Version :10

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster


Alignment Length:71 Identity:15/71 - (21%)
Similarity:27/71 - (38%) Gaps:15/71 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RNGFDLGLEPLRI------------LGACNWSGKLTFLMQWKG--CDEAGLVPAEVLNVRCPQMV 67
            :...||||....:            ||.....|:..:|.:|:|  .::....|.|.|. :|..::
  Fly     3 QKSIDLGLGVRNVKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLG-KCMTLI 66

  Fly    68 ISFYEE 73
            ..:..|
  Fly    67 ADYEAE 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 CSD 24..75 CDD:349275 12/64 (19%)
OxpNP_611240.1 CD_Rhino 21..71 CDD:349280 10/50 (20%)

Return to query results.
Submit another query.