DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and Oxp

DIOPT Version :9

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_611240.1 Gene:Oxp / 37002 FlyBaseID:FBgn0034255 Length:84 Species:Drosophila melanogaster


Alignment Length:71 Identity:15/71 - (21%)
Similarity:27/71 - (38%) Gaps:15/71 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RNGFDLGLEPLRI------------LGACNWSGKLTFLMQWKG--CDEAGLVPAEVLNVRCPQMV 67
            :...||||....:            ||.....|:..:|.:|:|  .::....|.|.|. :|..::
  Fly     3 QKSIDLGLGVRNVKEKSSEYIVEKFLGKRYLRGRPQYLTKWEGYPIEQCTWEPLENLG-KCMTLI 66

  Fly    68 ISFYEE 73
            ..:..|
  Fly    67 ADYEAE 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 11/63 (17%)
OxpNP_611240.1 CHROMO 21..72 CDD:237991 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.