DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and Cbx1

DIOPT Version :9

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_006247295.1 Gene:Cbx1 / 360609 RGDID:1310714 Length:193 Species:Rattus norvegicus


Alignment Length:85 Identity:44/85 - (51%)
Similarity:59/85 - (69%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALPV-----KQRNGFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISF 70
            |||:     ::..||..||||.||:||.:.||:|.|||:||..|||.||||:..||:|||:||||
  Rat   107 ALPIWFLQSEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISF 171

  Fly    71 YEERIVFTDEGDEEDLESDN 90
            ||||:.:.....|:|.:.|:
  Rat   172 YEERLTWHSYPSEDDDKKDD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 34/50 (68%)
Cbx1XP_006247295.1 Chromo 27..70 CDD:278797
Chromo_shadow 126..177 CDD:279701 34/50 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.