DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and HP1D3csd

DIOPT Version :10

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_573358.1 Gene:HP1D3csd / 32906 FlyBaseID:FBgn0030994 Length:179 Species:Drosophila melanogaster


Alignment Length:30 Identity:8/30 - (26%)
Similarity:16/30 - (53%) Gaps:0/30 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FLMQWKGCDEAGLVPAEVLNVRCPQMVISF 70
            |::.|||......||.:.:....|:::|.:
  Fly   142 FIVTWKGSKWGEAVPVQEIKHVHPKLLIDY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 CSD 24..75 CDD:349275 8/30 (27%)
HP1D3csdNP_573358.1 None

Return to query results.
Submit another query.