DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and Cbx8

DIOPT Version :10

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001029250.1 Gene:Cbx8 / 303731 RGDID:1565375 Length:366 Species:Rattus norvegicus


Alignment Length:66 Identity:16/66 - (24%)
Similarity:33/66 - (50%) Gaps:15/66 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GKLTFLMQWKGCDE--AGLVPAE-VLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGYETTPSP 98
            |::.:|::|||..:  :...|.| :|:.|    :::.:|||        |.::|.....:..|.|
  Rat    24 GRMEYLVKWKGWSQKYSTWEPEENILDAR----LLAAFEER--------EREMELYGPKKRGPKP 76

  Fly    99 R 99
            :
  Rat    77 K 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 CSD 24..75 CDD:349275 11/40 (28%)
Cbx8NP_001029250.1 CD_polycomb_like 11..59 CDD:349277 9/38 (24%)
CBX7_C 326..358 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.