DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and Cbx5

DIOPT Version :9

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001100267.1 Gene:Cbx5 / 300266 RGDID:1306619 Length:191 Species:Rattus norvegicus


Alignment Length:94 Identity:39/94 - (41%)
Similarity:59/94 - (62%) Gaps:13/94 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SSTALPVKQR----------NGFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVR 62
            |::|..:|.:          .||:.||||.:|:||.:..|.|.|||:||..|||.||.|:..||:
  Rat    95 SNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVK 159

  Fly    63 CPQMVISFYEERI---VFTDEGDEEDLES 88
            |||:||:|||||:   .:.::.:.::.||
  Rat   160 CPQIVIAFYEERLTWHAYPEDAENKEKES 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 30/53 (57%)
Cbx5NP_001100267.1 CD_HP1alpha_Cbx5 19..68 CDD:349298
CSD_HP1alpha_Cbx5 116..173 CDD:349302 34/56 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.