DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and Cbx3

DIOPT Version :10

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001008314.2 Gene:Cbx3 / 297093 RGDID:1549705 Length:183 Species:Rattus norvegicus


Alignment Length:66 Identity:35/66 - (53%)
Similarity:49/66 - (74%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISFYEERIVFTDEGDE 83
            ||..||:|.||:||.:.||:|.|||:||..|||.||.|:..|::|||:||:|||||:.:....::
  Rat   116 GFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPED 180

  Fly    84 E 84
            |
  Rat   181 E 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 CSD 24..75 CDD:349275 30/50 (60%)
Cbx3NP_001008314.2 CD_HP1gamma_Cbx3 29..78 CDD:349299
CSD_HP1gamma_Cbx3 116..173 CDD:349303 34/56 (61%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.