DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and CBX5

DIOPT Version :9

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001120793.1 Gene:CBX5 / 23468 HGNCID:1555 Length:191 Species:Homo sapiens


Alignment Length:94 Identity:38/94 - (40%)
Similarity:59/94 - (62%) Gaps:13/94 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SSTALPVKQR----------NGFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVR 62
            |::|..:|.:          .||:.||||.:|:||.:..|.|.|||:||..|||.||.|:..||:
Human    95 SNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVK 159

  Fly    63 CPQMVISFYEERI---VFTDEGDEEDLES 88
            |||:||:|||||:   .:.::.:.::.|:
Human   160 CPQIVIAFYEERLTWHAYPEDAENKEKET 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 30/53 (57%)
CBX5NP_001120793.1 CD_HP1alpha_Cbx5 19..68 CDD:349298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 3/21 (14%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 34/56 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.