DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and CBX6

DIOPT Version :10

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_055107.3 Gene:CBX6 / 23466 HGNCID:1556 Length:412 Species:Homo sapiens


Alignment Length:65 Identity:13/65 - (20%)
Similarity:26/65 - (40%) Gaps:13/65 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GKLTFLMQWKG--CDEAGLVPAEVLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGYETTPSPR 99
            |::.:|::|||  ...:...|.|           :..:.|::...|..|.:.|.....:..|.|:
Human    24 GRIEYLVKWKGWAIKYSTWEPEE-----------NILDSRLIAAFEQKERERELYGPKKRGPKPK 77

  Fly   100  99
            Human    78  77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 CSD 24..75 CDD:349275 7/39 (18%)
CBX6NP_055107.3 CD_Cbx6 8..65 CDD:349295 10/51 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..152
PRK12323 <237..>331 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..364
CBX7_C 357..388 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.