DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and cec-3

DIOPT Version :9

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_495652.1 Gene:cec-3 / 174265 WormBaseID:WBGene00011636 Length:339 Species:Caenorhabditis elegans


Alignment Length:97 Identity:22/97 - (22%)
Similarity:35/97 - (36%) Gaps:31/97 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LTFLMQW--KGCDEAGLVPAEVLNVRCPQMVISFYEERIVFTDEGD------------------- 82
            |...::|  .|.||....|.|.|. .|...|::.|.:::..||:.:                   
 Worm    39 LVLQVRWLGYGADEDTWEPEEDLQ-ECASEVVAEYYKKLKVTDKTELIELLQKQIKKNKSQKSKK 102

  Fly    83 --------EEDLESDNGYETTPSPRKKRSRNA 106
                    |.:.:||..| .||...||..::|
 Worm   103 RSKTVSDHESNHDSDGSY-GTPKTSKKSKKSA 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 11/38 (29%)
cec-3NP_495652.1 Chromo 25..75 CDD:278797 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.