powered by:
Protein Alignment HP6 and W05F2.8
DIOPT Version :9
Sequence 1: | NP_608842.1 |
Gene: | HP6 / 33661 |
FlyBaseID: | FBgn0031613 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001249353.1 |
Gene: | W05F2.8 / 13179739 |
WormBaseID: | WBGene00195045 |
Length: | 132 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 10/38 - (26%) |
Similarity: | 19/38 - (50%) |
Gaps: | 5/38 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 EERIVFTDEGDEEDLESDNGY-----ETTPSPRKKRSR 104
::|::..|:.|:|..|...|: |.....|:|.|:
Worm 13 KKRLIGEDDADDEWPEMPPGHRILTTEEHEMQRRKESK 50
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HP6 | NP_608842.1 |
Chromo_shadow |
25..76 |
CDD:279701 |
1/3 (33%) |
W05F2.8 | NP_001249353.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1911 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.