powered by:
Protein Alignment HP6 and Cdyl
DIOPT Version :9
Sequence 1: | NP_608842.1 |
Gene: | HP6 / 33661 |
FlyBaseID: | FBgn0031613 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_034011.1 |
Gene: | Cdyl / 12593 |
MGIID: | 1339956 |
Length: | 593 |
Species: | Mus musculus |
Alignment Length: | 76 |
Identity: | 21/76 - (27%) |
Similarity: | 30/76 - (39%) |
Gaps: | 11/76 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 NWSGKLTFLMQWKGCD-EAGLVPAEVLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGYETTPS 97
|..||..:|::|||.| |......|...|.|.:.:..|.... :|...|......:..|
Mouse 67 NKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRH-------NERQKEGSLARASRAS 124
Fly 98 P---RKKRSRN 105
| ||:.||:
Mouse 125 PSNARKQISRS 135
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1911 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.