DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HP6 and Cdyl

DIOPT Version :9

Sequence 1:	NP_608842.1	Gene:	HP6 / 33661	FlyBaseID:	FBgn0031613	Length:	106	Species:	Drosophila melanogaster
Sequence 2:	NP_034011.1	Gene:	Cdyl / 12593	MGIID:	1339956	Length:	593	Species:	Mus musculus

Alignment Length:	76	Identity:	21/76 - (27%)
Similarity:	30/76 - (39%)	Gaps:	11/76 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    34 NWSGKLTFLMQWKGCD-EAGLVPAEVLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGYETTPS 97
            |..||..:|::|||.| |......|...|.|.:.:..|....       :|...|......:..|
Mouse    67 NKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRH-------NERQKEGSLARASRAS 124

  Fly    98 P---RKKRSRN 105
            |   ||:.||:
Mouse   125 PSNARKQISRS 135

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HP6	NP_608842.1	Chromo_shadow	25..76	CDD:279701	13/42 (31%)
Cdyl	NP_034011.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..30
		CHROMO	55..109	CDD:214605	13/48 (27%)
		Interaction with EZH2. /evidence=ECO:0000250\|UniProtKB:Q9Y232	56..304		21/76 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	110..158		8/26 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	200..223
		crotonase-like	339..535	CDD:119339
		Acetyl-CoA-binding domain. /evidence=ECO:0000255	357..589
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1911
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810