DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and Cbx3

DIOPT Version :9

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001341931.1 Gene:Cbx3 / 12417 MGIID:108515 Length:183 Species:Mus musculus


Alignment Length:66 Identity:35/66 - (53%)
Similarity:49/66 - (74%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISFYEERIVFTDEGDE 83
            ||..||:|.||:||.:.||:|.|||:||..|||.||.|:..|::|||:||:|||||:.:....::
Mouse   116 GFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPED 180

  Fly    84 E 84
            |
Mouse   181 E 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 30/50 (60%)
Cbx3NP_001341931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
CD_HP1gamma_Cbx3 29..78 CDD:349299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..125 5/8 (63%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303 34/56 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.