DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HP6 and cbx7b

DIOPT Version :9

Sequence 1:	NP_608842.1	Gene:	HP6 / 33661	FlyBaseID:	FBgn0031613	Length:	106	Species:	Drosophila melanogaster
Sequence 2:	XP_009304967.1	Gene:	cbx7b / 101882803	ZFINID:	ZDB-GENE-110613-2	Length:	239	Species:	Danio rerio

Alignment Length:	40	Identity:	12/40 - (30%)
Similarity:	24/40 - (60%)	Gaps:	5/40 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    37 GKLTFLMQWKGCDE--AGLVPAEVLNVRCPQMVISFYEER 74
            |.:.:|::|||...  :...|.|  ::..|::|:: |||:
Zfish    24 GHVEYLLKWKGWPPKYSTWEPEE--HILDPRLVLA-YEEK 60

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HP6	NP_608842.1	Chromo_shadow	25..76	CDD:279701	12/40 (30%)
cbx7b	XP_009304967.1	CHROMO	10..62	CDD:214605	12/40 (30%)
cbx7b	XP_009304967.1	CBX7_C	197..228	CDD:319236
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	2.010