powered by:
Protein Alignment HP6 and cbx7b
DIOPT Version :9
Sequence 1: | NP_608842.1 |
Gene: | HP6 / 33661 |
FlyBaseID: | FBgn0031613 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009304967.1 |
Gene: | cbx7b / 101882803 |
ZFINID: | ZDB-GENE-110613-2 |
Length: | 239 |
Species: | Danio rerio |
Alignment Length: | 40 |
Identity: | 12/40 - (30%) |
Similarity: | 24/40 - (60%) |
Gaps: | 5/40 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 GKLTFLMQWKGCDE--AGLVPAEVLNVRCPQMVISFYEER 74
|.:.:|::|||... :...|.| ::..|::|:: |||:
Zfish 24 GHVEYLLKWKGWPPKYSTWEPEE--HILDPRLVLA-YEEK 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000191 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.