DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and cbx3

DIOPT Version :9

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_017949990.2 Gene:cbx3 / 100038121 XenbaseID:XB-GENE-492315 Length:227 Species:Xenopus tropicalis


Alignment Length:71 Identity:38/71 - (53%)
Similarity:52/71 - (73%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKQRNGFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISFYEERIVFT 78
            |.:..||..||:|.||:||.:.||:|.|||:||..|||.||||:..||:|||:||:|||||:.:.
 Frog   155 VDKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVPAKEANVKCPQVVIAFYEERLTWH 219

  Fly    79 DEGDEE 84
            ...::|
 Frog   220 SCPEDE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 32/50 (64%)
cbx3XP_017949990.2 CD_HP1gamma_Cbx3 72..121 CDD:349299
CSD_HP1beta_Cbx1 160..217 CDD:349301 36/56 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.