DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ine and SLC6A4

DIOPT Version :9

Sequence 1:NP_001162871.1 Gene:ine / 33659 FlyBaseID:FBgn0011603 Length:943 Species:Drosophila melanogaster
Sequence 2:NP_001036.1 Gene:SLC6A4 / 6532 HGNCID:11050 Length:630 Species:Homo sapiens


Alignment Length:589 Identity:228/589 - (38%)
Similarity:356/589 - (60%) Gaps:30/589 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 PPLGVDDDDSYLDMSDET---AQL-KPRQQHWANKMQFVLACIGYSVGLGNVWRFPYMCYKSGGG 373
            |..|..||..:...:..|   |:| :..::.|..|:.|:|:.|||:|.|||||||||:||::|||
Human    51 PSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGG 115

  Fly   374 VFLVPYCIILFICSIPLLFMELSVGQYTGRGPIGALGQLCPLFKGAGLASVVVSFLMSTYYSVII 438
            .||:||.|:.....|||.:|||::|||...|.|....::||:|||.|.|..:::|.:::||:.|:
Human   116 AFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM 180

  Fly   439 GYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDT------SRTPSEEFFENKVLQ 497
            .:::||..:||..::||..|.|.|||.:|       .|..:.|.      |.:|:|||:...|||
Human   181 AWALYYLISSFTDQLPWTSCKNSWNTGNC-------TNYFSEDNITWTLHSTSPAEEFYTRHVLQ 238

  Fly   498 I--SGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSAKVRYFTATFPFVLIIILMVRAVTLD 560
            |  |.||:..|.:.|:|..|::..:.::||:.||.:|:|.||.:.|||||::::.:|:||..||.
Human   239 IHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLP 303

  Fly   561 GAAEGLRFFFRPKWSELKNANVWINAASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVN 625
            ||..|:.|:.:|.|.:|....|||:||:|.|.|||..||.:::||||||:|||..:|.:..|.||
Human   304 GAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVN 368

  Fly   626 MITSLLVGIFAFSTLGNLALEQNTNVRDVIGD-GPGMIFVVYPQAMAKMPYAQLWAVMFFFMLLC 689
            .:||.:.|...|:.||.:|..:|.:|.:|..| ||.::|:.|.:|:|.||.:..:|::||.||:.
Human   369 CMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLIT 433

  Fly   690 LGLNSQFAIVEVVVTSIQDGFPR-WIKRHLGYHEIVVLFVCVISCLFG-MPNIIQGGIYYFQLMD 752
            |||:|.||.:|.|:|::.|.||. |.||    .|..||.| ||:|.|| :..:..||.|..:|::
Human   434 LGLDSTFAGLEGVITAVLDEFPHVWAKR----RERFVLAV-VITCFFGSLVTLTFGGAYVVKLLE 493

  Fly   753 HYAASVTIMFLAFCQMIAIAWFYGTGRLSKNVKQMTGKAPSFYLRSCWLVLGPCLLFAIWVLSLI 817
            .||....::.:|..:.:|::||||..:..::||:|.|.:|.::.|.||:.:.|  ||.::::...
Human   494 EYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISP--LFLLFIICSF 556

  Fly   818 NYHEPTYHNGRYTYPDWAYGIGWMFASFSLICIPGYAVINFLRSSGDTFWERIRNTLRPNIYECK 882
            ....|.....:|.||.|:..:|:...:.|.||||.|.....:.:.| ||.|||..::.|......
Human   557 LMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPG-TFKERIIKSITPETPTEI 620

  Fly   883 ICGE 886
            .||:
Human   621 PCGD 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ineNP_001162871.1 SLC5-6-like_sbd 337..876 CDD:294310 218/549 (40%)
SLC6A4NP_001036.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59 3/7 (43%)
5HT_transport_N 24..64 CDD:397524 4/12 (33%)
SLC6sbd_SERT 79..615 CDD:271399 218/550 (40%)
Interaction with RAB4A 616..624 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.