DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ine and CG13793

DIOPT Version :9

Sequence 1:NP_001162871.1 Gene:ine / 33659 FlyBaseID:FBgn0011603 Length:943 Species:Drosophila melanogaster
Sequence 2:NP_609136.2 Gene:CG13793 / 34047 FlyBaseID:FBgn0031935 Length:583 Species:Drosophila melanogaster


Alignment Length:522 Identity:115/522 - (22%)
Similarity:213/522 - (40%) Gaps:86/522 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 HWANKMQFVLACIGYSVGL----GNVWRFPYMCYKSGGGVF-LVPYCIILFICSIPLLFMELSVG 398
            :|.....::.||.|.::.|    .:.|.|      ...|:| :|||.:.:.|..:|::.:...:|
  Fly    14 NWEKPTDYIFACFGLALKLDIFVASFWFF------FNTGIFGMVPYLMYMVIYLVPIMVIHSYMG 72

  Fly   399 QYTGRGPIGALGQLCPLFKGAGLASVVVSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNN--- 460
            |::..|.|.|. :|.|||||.|..|:.::..:..||::.....:.:...||:..:|| .|..   
  Fly    73 QFSSSGFISAF-RLSPLFKGMGYVSLFLTITLLIYYTIFAAVPLLFVLNSFRPTLPW-SCEGFKS 135

  Fly   461 -------RWNTPDCWVPQRKGINASAPDT------SRTPSEEFFENKVLQISGGLEYPGM-MRWE 511
                   :|:..:..:.:... ..:..||      ...||..:|::.........|.... :.|.
  Fly   136 WQNDTIAKWSICNATIAEEVA-KETENDTYFYITNIHVPSVLYFKSHFESFQNDSELNDYEISWH 199

  Fly   512 LFACLICAWLMVYFATWKSIKSSAK----VRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRP 572
            |.......|..:.|..:| ....||    :||.... ...|:::..||.:.|.||..||:.:..|
  Fly   200 LSGLFALVWATIAFIFYK-FSEPAKFGKCIRYMVIG-TVALLLVCFVRFLFLPGAHLGLKNYMTP 262

  Fly   573 KWSELKNANVWINAASQNF----NSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVG 633
            ...|      ::...|..|    .:.|..:||:|:.:|:|.:..||:..:..:|...:...::.|
  Fly   263 SIEE------FVVGTSSTFIMALQAFGAGWGSVITLSSFNGFKTNIMSYSWIISFGQIFIYIMFG 321

  Fly   634 IFAFSTLGN--LALEQNTNVRDVIGDGPGMIFVVYPQAMAKMPYAQLWAVMFFFMLLCLGLNSQF 696
            :.:| .|.:  |.|.:......||..  .::|:....|::.:.:..||..:::.|||...|   .
  Fly   322 MVSF-MLEHYFLGLPKPLFETQVINH--WVLFLSSASALSSLGWPNLWTFIYYTMLLMAAL---I 380

  Fly   697 AIVEVVVTSIQDGFPRWIKRHLGYHEIVV-----LFVCVISCLFGMPNIIQGGIYYFQLMDHYAA 756
            .|...:.|.:|..|..:.:......|:.:     |.||   .|:...|   .|:.||.::...|.
  Fly   381 VITTQIFTILQSLFDEFEQLRAKKQEVTLGLIGGLAVC---SLYFCTN---HGVLYFAILSIDAI 439

  Fly   757 -SVTIMFLAFCQMIAIAWFYGTGRLSKNVKQMTGKAPSFYLRSCWLVLGPCLLFAIWVLSLINYH 820
             |.|::.|..  ::.:.|.||..|..|::|.|.|:.                 ||.|.:.::.:.
  Fly   440 FSQTLLHLLL--LLVVLWVYGRDRFQKDIKFMLGQP-----------------FASWKVFILRFV 485

  Fly   821 EP 822
            .|
  Fly   486 AP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ineNP_001162871.1 SLC5-6-like_sbd 337..876 CDD:294310 115/522 (22%)
CG13793NP_609136.2 SLC5-6-like_sbd 19..498 CDD:271356 114/517 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473200
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.