DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ine and CG31904

DIOPT Version :10

Sequence 1:NP_477012.1 Gene:ine / 33659 FlyBaseID:FBgn0011603 Length:943 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:137 Identity:37/137 - (27%)
Similarity:65/137 - (47%) Gaps:18/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 WANKMQFVLACIGYSVGLGNVWRFPYMCYKS--------GGG-VFLVPYCIILFICSIPLLFMEL 395
            ||....|..|...::        |..:.:..        ||. :|::.|.:.:...|:|:..::.
  Fly    87 WAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQA 143

  Fly   396 SVGQYTGRGPIGALGQLCPLFKGAGLASVVVSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNN 460
            .:||::..|.|.|. ::.|:|||.|.|.::::....||||:.....:.|...|....:||:.|||
  Fly   144 FLGQFSSSGTISAF-RVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNN 207

  Fly   461 RWNTPDC 467
            .|||.:|
  Fly   208 SWNTQEC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ineNP_477012.1 SLC5-6-like_sbd 337..876 CDD:444915 37/137 (27%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 30/93 (32%)
Cuticle_4 276..344 CDD:464954
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.