DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FIG4 and SYNJ1

DIOPT Version :9

Sequence 1:NP_608841.1 Gene:FIG4 / 33658 FlyBaseID:FBgn0031611 Length:858 Species:Drosophila melanogaster
Sequence 2:NP_003886.3 Gene:SYNJ1 / 8867 HGNCID:11503 Length:1612 Species:Homo sapiens


Alignment Length:556 Identity:157/556 - (28%)
Similarity:235/556 - (42%) Gaps:130/556 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FRLLTIDRLAHNRLSIEENANEFNSLEIRRFVASLSGS---------PKVTSAYGVLGFVRFLEG 96
            |.|:...|.....|..|..|           ||.||.:         .||..|||:||.:|...|
Human    57 FSLIVETRHKEECLMFESGA-----------VAVLSSAEKEAIKGTYSKVLDAYGLLGVLRLNLG 110

  Fly    97 ----YYLLLVTKRKCCAHIGRHLVYTIKDTVMVRV--NEVTSQRPPHPHEDRYKRMFQNIDLRSN 155
                :||:|||.   |..:|:     |:::.:.||  .|..|.|.....|||...:.:.:: ..|
Human   111 DTMLHYLVLVTG---CMSVGK-----IQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLN-SGN 166

  Fly   156 FYFSYSYDLTRTLQYNESAPRYVGAKVDLDRDEPLPDWNTLTSNVDKAHERVDYAFRSDSRKRFV 220
            |||::|..               |..:||..:               ||..:.   ...:..||.
Human   167 FYFAWSAS---------------GISLDLSLN---------------AHRSMQ---EQTTDNRFF 198

  Fly   221 WNAYLLQPME--GIMLKDWLLEVTHGFVSQSCISIFGRHVNVCLVARRSSRFAGTRFLKRGANFQ 283
            ||..|...::  |:...||||.:..|.|....|....:....||::|.|...|||||..||.|..
Human   199 WNQSLHLHLKHYGVNCDDWLLRLMCGGVEIRTIYAAHKQAKACLISRLSCERAGTRFNVRGTNDD 263

  Fly   284 GDVANEVETEQIVSDGQRICAFTQMRGSIPSHWSQDISKMVPKPQIQLDI--------CDPYAQT 340
            |.|||.|||||:|.....:.:|.|:|||:|..|.|        |.:|:..        .:..|..
Human   264 GHVANFVETEQVVYLDDSVSSFIQIRGSVPLFWEQ--------PGLQVGSHRVRMSRGFEANAPA 320

  Fly   341 PSLHFERLLFHYGAPLIMLNLVKKRERRKHESIISKELEYSIRYLNQFLPPPHR--MKHIHFDMA 403
            ...||..|...||..:| :||:..:|   .|.::||..:..::      ...|.  ::.::||. 
Human   321 FDRHFRTLKNLYGKQII-VNLLGSKE---GEHMLSKAFQSHLK------ASEHAADIQMVNFDY- 374

  Fly   404 RQSRLSGGNVMEQLAIHAESIVQ--MTGMFFKAAGSE-PGLQTGIVRTNCVDCLDRTNSAQFAIG 465
             ...:.||.. |:|....:..||  :...||...||| ...|:|.|||||:||||||||.|..:|
Human   375 -HQMVKGGKA-EKLHSVLKPQVQKFLDYGFFYFNGSEVQRCQSGTVRTNCLDCLDRTNSVQAFLG 437

  Fly   466 KCALGHQLERLGFVKSAKLEFDSDCVTMLENLYEE----HGDTLALQYGGSQLVH---RIKTYRK 523
            ...|..|||.||..:..:|      ||..:.::..    :||:::..|.|:..:.   ::|    
Human   438 LEMLAKQLEALGLAEKPQL------VTRFQEVFRSMWSVNGDSISKIYAGTGALEGKAKLK---- 492

  Fly   524 TAPWGSQGSDVMQTLSRYYSNTFSDTEKQHSINLFL 559
                     |..::::|...|.|.|:.||.:|::.|
Human   493 ---------DGARSVTRTIQNNFFDSSKQEAIDVLL 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FIG4NP_608841.1 COG5329 19..599 CDD:227637 157/556 (28%)
Syja_N 85..407 CDD:280532 93/339 (27%)
SYNJ1NP_003886.3 Syja_N 99..379 CDD:280532 93/341 (27%)
INPP5c_Synj1 572..907 CDD:197332
DUF1866 906..1047 CDD:286093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.