DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FIG4 and SAC8

DIOPT Version :9

Sequence 1:NP_608841.1 Gene:FIG4 / 33658 FlyBaseID:FBgn0031611 Length:858 Species:Drosophila melanogaster
Sequence 2:NP_190751.2 Gene:SAC8 / 824346 AraportID:AT3G51830 Length:588 Species:Arabidopsis thaliana


Alignment Length:543 Identity:156/543 - (28%)
Similarity:251/543 - (46%) Gaps:99/543 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TIDRLAHNRLSIEENANEFNSLEIRRFVASLSGSP-KVTSAYGVLGFVRFLEGYYLLLVTKRKCC 108
            :::|...|...::|||:              |||| :|::.|||.|.:|.|.|.|||::|.|:  
plant    38 SVNRRDGNIKPLDENAS--------------SGSPTRVSTIYGVGGTIRLLAGTYLLVITSRE-- 86

  Fly   109 AHIGRHL---VYTIKDTVMVRVNE----VTSQRPPHPHEDRYKRMFQNIDLRSNFYFSYSYDLTR 166
             .:|..|   ::.:.....:..||    .|:|.  ...|..::.:.|.::.....||||..|||.
plant    87 -EVGNFLGLPIFRVTAMKFLPCNEALRFATAQE--KKDETYFRTLLQALETTPGLYFSYETDLTL 148

  Fly   167 TLQYNESAPRYVGAKVDLDRDEPLPDWNTLTSNVDKAHERVDYAFRSDSRKRFVWNAYLLQPMEG 231
            .||               .|.:....||           |.....::|  .|:|||.:||:.:..
plant   149 NLQ---------------RRCKLAEGWN-----------RKPMWKQAD--PRYVWNWHLLEDLIE 185

  Fly   232 IMLKDWLLEVTHGFVSQSCISIFGRHVNVCLVARRSSRFAGTRFLKRGANFQGDVANEVETEQIV 296
            ..|..:::.:..|....:.:.:......|.:::||.:|..|||..:||||.:||.||.||:||||
plant   186 CKLDGFIIPILQGSYQVAELKLKNSPAVVSIMSRRCTRRLGTRMWRRGANLEGDAANFVESEQIV 250

  Fly   297 SDGQRICAFTQMRGSIPSHWSQ--DISKMVPKPQIQLDICDPYAQTPSL---HFERLLFHYGAPL 356
            .......:..|:|||||..|.|  |:|.   ||::::   :.:.:||.:   ||..|...||.  
plant   251 EINGFKFSLLQVRGSIPLLWEQIVDLSY---KPRLKI---NKHEETPKVVQRHFHDLCQRYGE-- 307

  Fly   357 IMLNLVKKRERRKHESIISK----ELEYSIRYLNQFLPPPHRMKHIHFDMARQSRLSGGNVMEQL 417
              :..|...::...|..:||    |:|.        ||.   ::::.||.   .::.|....:.|
plant   308 --IMAVDLTDQHGDEGALSKAYATEMEK--------LPD---VRYVSFDF---HQVCGTTNFDNL 356

  Fly   418 AIHAESI---VQMTGMFFKAAGSEPGL--QTGIVRTNCVDCLDRTNSAQFAIGKCALGHQLERLG 477
            .:..|.|   .:..| :|.....|..|  |.|::|:||:|||||||..|..:|:.:|..||:|:|
plant   357 GVLYEQIGDEFEKQG-YFLVDADENILEEQKGVIRSNCIDCLDRTNVTQSFMGQKSLNLQLQRIG 420

  Fly   478 FVKSAKL--EFDSDCVTMLENLYEEHGDTLALQYGGS-QLVHRIKTYRKTAPWGSQGSDVMQTLS 539
            ...|.:.  .|:.| .|....::.|.||.::|||.|: .|...:..|.|....|:. .|.:..:|
plant   421 VCDSTECISTFEDD-YTKFRTIWAEQGDEVSLQYAGTYALKGDLVRYGKQTMTGAI-KDGLSAMS 483

  Fly   540 RYYSNTFSDTEKQHSINLFLGIY 562
            |||.|.|.|..:|.:::|..|.|
plant   484 RYYLNNFQDGVRQDALDLISGRY 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FIG4NP_608841.1 COG5329 19..599 CDD:227637 156/543 (29%)
Syja_N 85..407 CDD:280532 92/337 (27%)
SAC8NP_190751.2 Syja_N 65..348 CDD:280532 92/339 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5329
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.