Sequence 1: | NP_608841.1 | Gene: | FIG4 / 33658 | FlyBaseID: | FBgn0031611 | Length: | 858 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611178.1 | Gene: | CG6805 / 36911 | FlyBaseID: | FBgn0034179 | Length: | 357 | Species: | Drosophila melanogaster |
Alignment Length: | 199 | Identity: | 37/199 - (18%) |
---|---|---|---|
Similarity: | 62/199 - (31%) | Gaps: | 71/199 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 CAHIGRHLVYTIKDTVMVRVNEVTSQRPPHPHEDR-YKRMFQNIDLRSNFYFSYSYDLTRTLQYN 171
Fly 172 ESA---------PRYVG-AKVD--------------LDRDEP-------------------LPDW 193
Fly 194 ---------------NTLTSNVDKAHERVDYAFRSDSRKRFVWNAYLLQPMEGIMLKDWLLEVTH 243
Fly 244 GFVS 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FIG4 | NP_608841.1 | COG5329 | 19..599 | CDD:227637 | 37/199 (19%) |
Syja_N | 85..407 | CDD:280532 | 37/199 (19%) | ||
CG6805 | NP_611178.1 | EEP | 12..308 | CDD:294334 | 30/172 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45447394 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |