DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FIG4 and CG6805

DIOPT Version :9

Sequence 1:NP_608841.1 Gene:FIG4 / 33658 FlyBaseID:FBgn0031611 Length:858 Species:Drosophila melanogaster
Sequence 2:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster


Alignment Length:199 Identity:37/199 - (18%)
Similarity:62/199 - (31%) Gaps:71/199 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 CAHIGRHLVYTIKDTVMVRVNEVTSQRPPHPHEDR-YKRMFQNIDLRSNFYFSYSYDLTRTLQYN 171
            |:|:..|     .:.:..|:.:.......|.:..: |:|:|.:     :|.|.:. ||...|..:
  Fly   147 CSHLAAH-----DEKLKERIEDYHQIVDNHKYNAQGYRRIFDH-----DFVFWFG-DLNFRLSGD 200

  Fly   172 ESA---------PRYVG-AKVD--------------LDRDEP-------------------LPDW 193
            .||         .||.. .|:|              |:..:|                   .|.|
  Fly   201 MSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDYNLKRRPAW 265

  Fly   194 ---------------NTLTSNVDKAHERVDYAFRSDSRKRFVWNAYLLQPMEGIMLKDWLLEVTH 243
                           .||::|.......:||.. ||.:.......|.::........:.|.|:||
  Fly   266 CDRILHRVQSNIYPGITLSANQLSYQSHMDYTL-SDHKPVSATFNYKVEAANQTYTDEELHEMTH 329

  Fly   244 GFVS 247
            |..|
  Fly   330 GSAS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FIG4NP_608841.1 COG5329 19..599 CDD:227637 37/199 (19%)
Syja_N 85..407 CDD:280532 37/199 (19%)
CG6805NP_611178.1 EEP 12..308 CDD:294334 30/172 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.