DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FIG4 and Synj2

DIOPT Version :10

Sequence 1:NP_608841.1 Gene:FIG4 / 33658 FlyBaseID:FBgn0031611 Length:858 Species:Drosophila melanogaster
Sequence 2:NP_001106824.1 Gene:Synj2 / 20975 MGIID:1201671 Length:1479 Species:Mus musculus


Alignment Length:56 Identity:14/56 - (25%)
Similarity:23/56 - (41%) Gaps:19/56 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FRSLASTDGCTL----------------IVFAVPTTGVDRLLNVVSKIII--PQAI 81
            |.||.:..|..|                :||:...|..|:.: .|.||::  ||::
Mouse     5 FESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDTDCDKRV-AVKKIVLTDPQSV 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FIG4NP_608841.1 Syja_N 85..407 CDD:460545
Synj2NP_001106824.1 COG5329 30..485 CDD:227637 9/31 (29%)
EEP 530..861 CDD:469791
DUF1866 872..1008 CDD:286093
Atrophin-1 1120..>1455 CDD:460830
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.