DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and STP4

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_010235.1 Gene:STP4 / 851512 SGDID:S000002206 Length:490 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:55/232 - (23%)
Similarity:78/232 - (33%) Gaps:60/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ASAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFP--CPYCKRNFRLRVTLKAH 172
            :|:..|..|...::...||..||..|....|   |..||:..:..|  ||.|:|.|.....|..|
Yeast   261 SSSLKDSAKITKQRKKKECPICHNFYANLST---HKSTHLTPEDRPHKCPICQRGFARNNDLIRH 322

  Fly   173 MKTH--------------NAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKT-FIKS 222
            .|.|              |.:...:....|:|.|...:..|:::....      |...:| .:|.
Yeast   323 KKRHWKDEFMQIYARESDNNSGADDQDDTARTSANNDSDDSNDKLAAS------SSSEETKLLKK 381

  Fly   223 SDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGE----RPFKC------SHCPKAFAM 277
            :.|:...:..|:   |||...:..    .:||.....|...    .|..|      |.|.   ..
Yeast   382 NQLKSLYKIKGA---FKCPYNSTL----INLDMEVYPHKSRSLYFEPINCHQTGVFSRCD---TF 436

  Fly   278 KQHLKQHSRLHL--------PDR---PFRCSHCPKTF 303
            |.|||   .||.        .||   |.:|.||...|
Yeast   437 KNHLK---ALHFEYPPKTKKEDRGVVPGKCKHCGLQF 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 6/19 (32%)
C2H2 Zn finger 156..176 CDD:275368 8/19 (42%)
COG5048 <180..341 CDD:227381 32/146 (22%)
C2H2 Zn finger 184..204 CDD:275368 4/19 (21%)
zf-H2C2_2 197..219 CDD:290200 3/22 (14%)
C2H2 Zn finger 212..232 CDD:275368 4/20 (20%)
zf-H2C2_2 224..249 CDD:290200 5/24 (21%)
C2H2 Zn finger 240..260 CDD:275368 3/19 (16%)
zf-H2C2_2 252..276 CDD:290200 7/33 (21%)
C2H2 Zn finger 268..288 CDD:275368 7/25 (28%)
C2H2 Zn finger 296..316 CDD:275368 4/8 (50%)
C2H2 Zn finger 324..341 CDD:275368
STP4NP_010235.1 COG5048 14..442 CDD:227381 46/202 (23%)
C2H2 Zn finger 279..296 CDD:275368 6/19 (32%)
C2H2 Zn finger 306..326 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.