DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and TFIIIA

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001322779.1 Gene:TFIIIA / 843536 AraportID:AT1G72050 Length:427 Species:Arabidopsis thaliana


Alignment Length:373 Identity:84/373 - (22%)
Similarity:135/373 - (36%) Gaps:120/373 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ICPQCYEDVKSAYGIRQTCEESHQFYCRVRDEGIEDALCALLEEEDWEISEDEDARIDSASAADD 115
            :|..|.......|.|.:..:..||.                      |:.|:.|   |.|...|:
plant    36 LCQYCGISRSKNYLITKHIQSHHQM----------------------ELEEERD---DEACEVDE 75

  Fly   116 DGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPY---CKRNFRLRVTLKAHMKTHN 177
            :..|:     ..|:||..::::.....:||::|...:||.| |   |..::|.:..|..|:.||.
plant    76 ESSSN-----HTCQECGAEFKKPAHLKQHMQSHSLERSFTC-YVDDCAASYRRKDHLNRHLLTHK 134

  Fly   178 AAKPYEC--SHCAKTFAQQSTLQSH----------ERTHTG------------------------ 206
             .|.::|  .:|...|:.|..:..|          ::.:||                        
plant   135 -GKLFKCPKENCKSEFSVQGNVGRHVKKYHSNDNRDKDNTGLGDGDKDNTCKGDDDKEKSGSGGC 198

  Fly   207 -------------------ERPFKCSQ-----------CSKTFIKSSDLRRHIRTH---GSERPF 238
                               .:|.:||.           |.|.|...|.|::|..:|   .|...|
plant   199 EKENEGNGGSGKDNNGNGDSQPAECSTGQKQVVCKEIGCGKAFKYPSQLQKHQDSHVKLDSVEAF 263

  Fly   239 KCSK--CTKTFTRKFHLDNHFRS-HTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDR---PFRC- 296
             ||:  |.|.||.:..|.:|.|| |   :...|..|.... :|:::|:|.|.|..|.   ..:| 
plant   264 -CSEPGCMKYFTNEECLKSHIRSCH---QHINCEICGSKH-LKKNIKRHLRTHDEDSSPGEIKCE 323

  Fly   297 -SHCPKTFRLSSTLKEH-KLVHNAERTFKC--PHCASFYKQRKTLARH 340
             ..|..||..:|.|::| |.||:..|.|.|  |.|...:..:....:|
plant   324 VEGCSSTFSKASNLQKHMKAVHDDIRPFVCGFPGCGMRFAYKHVRNKH 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 6/26 (23%)
C2H2 Zn finger 128..148 CDD:275368 5/19 (26%)
C2H2 Zn finger 156..176 CDD:275368 6/22 (27%)
COG5048 <180..341 CDD:227381 55/241 (23%)
C2H2 Zn finger 184..204 CDD:275368 5/31 (16%)
zf-H2C2_2 197..219 CDD:290200 8/85 (9%)
C2H2 Zn finger 212..232 CDD:275368 8/30 (27%)
zf-H2C2_2 224..249 CDD:290200 10/29 (34%)
C2H2 Zn finger 240..260 CDD:275368 10/22 (45%)
zf-H2C2_2 252..276 CDD:290200 7/24 (29%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 8/22 (36%)
C2H2 Zn finger 324..341 CDD:275368 4/19 (21%)
TFIIIANP_001322779.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.