DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and AT3G29340

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:256 Identity:57/256 - (22%)
Similarity:90/256 - (35%) Gaps:53/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 KVAFECRECHKKYQRKGTFLRHMRTH------MDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKP 181
            |.:.:|:.|.|.::.......|.|.|      :..|.|...|.:::       |...:..:::..
plant    40 KSSHKCKICGKSFECYQALGGHQRIHRPIKEKLSKQEFSEVYPRKS-------KLQKRPESSSSC 97

  Fly   182 YECSHCAKTFAQQSTLQSHERTH-TGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTK 245
            |||..|.|.|.....|..|.:.| :.:|....:|...:.:.||:.::.:....|   ||.|:..|
plant    98 YECKVCGKIFGCYRGLGGHTKLHRSTKRELASTQDENSLLDSSEAKKIVSQPSS---FKVSQEEK 159

  Fly   246 TFTRKFHLDNHFR---SHTGERP----------------FKCSHCPKAFAMKQHLKQHSRLHLP- 290
             |.....|...|.   ||:|..|                ..|..|.|:|...|.|..|.|:|.. 
plant   160 -FLHCVELKQDFSEPLSHSGALPSTLRSKLQTKTQWKSSCHCKICGKSFVCSQGLGNHKRVHREI 223

  Fly   291 ------DRPFRCSHCPKTFRLSSTLKEHKLV-----HNAERTFKCPHCASFYKQRKTLARH 340
                  .|.:...:.|    .|.:||..|:|     ....:..|..||....:....|..|
plant   224 SGKLACKRKYTEDYNP----FSDSLKAKKIVKKPSSFEVSQEEKILHCVELKQDFGELLAH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 5/19 (26%)
C2H2 Zn finger 156..176 CDD:275368 2/19 (11%)
COG5048 <180..341 CDD:227381 46/193 (24%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
zf-H2C2_2 197..219 CDD:290200 5/22 (23%)
C2H2 Zn finger 212..232 CDD:275368 3/19 (16%)
zf-H2C2_2 224..249 CDD:290200 6/24 (25%)
C2H2 Zn finger 240..260 CDD:275368 5/22 (23%)
zf-H2C2_2 252..276 CDD:290200 9/42 (21%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 6/24 (25%)
C2H2 Zn finger 324..341 CDD:275368 4/17 (24%)
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 6/24 (25%)
C2H2 Zn finger 45..65 CDD:275368 5/19 (26%)
C2H2 Zn finger 100..120 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.