DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF157

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_003437.2 Gene:ZNF157 / 7712 HGNCID:12942 Length:506 Species:Homo sapiens


Alignment Length:215 Identity:91/215 - (42%)
Similarity:129/215 - (60%) Gaps:0/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKT 190
            |||.||.|.|.||...:.|:|.|...:.:.|..|.:.|..|..|.||.|||...:|:||:.|.|:
Human   162 FECHECGKAYCRKSNLVEHLRIHTGERPYECGECAKTFSARSYLIAHQKTHTGERPFECNECGKS 226

  Fly   191 FAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDN 255
            |.::|.|..|.||||||||::|::|.|||.:.:.|..|.|||..|:|::||:|.|||..|..|..
Human   227 FGRKSQLILHTRTHTGERPYECTECGKTFSEKATLTIHQRTHTGEKPYECSECGKTFRVKISLTQ 291

  Fly   256 HFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAER 320
            |.|:||||:|::|..|.|.|..|:.|.||.|:|..::|:.|..|.|.||:..||..|:..|..|:
Human   292 HHRTHTGEKPYECGECGKNFRAKKSLNQHQRIHTGEKPYECGECGKFFRMKMTLNNHQRTHTGEK 356

  Fly   321 TFKCPHCASFYKQRKTLARH 340
            .::|..|...::...:|..|
Human   357 PYQCNECGKSFRVHSSLGIH 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 9/19 (47%)
C2H2 Zn finger 156..176 CDD:275368 8/19 (42%)
COG5048 <180..341 CDD:227381 69/161 (43%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 13/21 (62%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 13/24 (54%)
C2H2 Zn finger 240..260 CDD:275368 10/19 (53%)
zf-H2C2_2 252..276 CDD:290200 11/23 (48%)
C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..341 CDD:275368 4/17 (24%)
ZNF157NP_003437.2 KRAB 27..87 CDD:214630
KRAB 27..66 CDD:279668
C2H2 Zn finger 137..156 CDD:275368
COG5048 159..499 CDD:227381 91/215 (42%)
C2H2 Zn finger 164..184 CDD:275368 9/19 (47%)
zf-H2C2_2 176..200 CDD:290200 5/23 (22%)
C2H2 Zn finger 192..212 CDD:275368 8/19 (42%)
zf-H2C2_2 204..229 CDD:290200 12/24 (50%)
C2H2 Zn finger 220..240 CDD:275368 8/19 (42%)
zf-H2C2_2 236..256 CDD:290200 13/19 (68%)
C2H2 Zn finger 248..268 CDD:275368 8/19 (42%)
zf-H2C2_2 261..283 CDD:290200 11/21 (52%)
C2H2 Zn finger 276..296 CDD:275368 10/19 (53%)
zf-H2C2_2 288..311 CDD:290200 11/22 (50%)
C2H2 Zn finger 304..324 CDD:275368 9/19 (47%)
zf-H2C2_2 316..339 CDD:290200 9/22 (41%)
C2H2 Zn finger 332..352 CDD:275368 8/19 (42%)
zf-H2C2_2 345..367 CDD:290200 6/21 (29%)
C2H2 Zn finger 360..380 CDD:275368 4/17 (24%)
zf-H2C2_2 372..395 CDD:290200 2/5 (40%)
C2H2 Zn finger 388..408 CDD:275368
zf-H2C2_2 401..424 CDD:290200
C2H2 Zn finger 416..436 CDD:275368
zf-H2C2_2 431..451 CDD:290200
C2H2 Zn finger 444..464 CDD:275368
zf-H2C2_2 457..479 CDD:290200
zf-C2H2 470..492 CDD:278523
C2H2 Zn finger 472..492 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.