DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF79

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_009066.2 Gene:ZNF79 / 7633 HGNCID:13153 Length:498 Species:Homo sapiens


Alignment Length:235 Identity:91/235 - (38%)
Similarity:131/235 - (55%) Gaps:1/235 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKT 175
            |:.....||.:.:..:||.||.|.:.:..:.::|.|.|...:.:.|..|.|.|.....|..|.:|
Human   206 SSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQRIHTGEKPYKCSECGRAFSQNANLTKHQRT 270

  Fly   176 HNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKC 240
            |...|||.||.|.|.|:..|.|..|:|.||||:|::||.|.|.|..|::|..|.|||..|:|:||
Human   271 HTGEKPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKC 335

  Fly   241 SKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRL 305
            |:|.|.|:.......|.|.||||:|::|:.|.|||:...:|..|.|.|..::|::||.|.|.|..
Human   336 SECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQ 400

  Fly   306 SSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIH 345
            |:.|..|:..|..|:.:||..|..|:.:...|.||.: ||
Human   401 STNLIIHQKTHTGEKPYKCNECGKFFSESSALIRHHI-IH 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 6/19 (32%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 69/160 (43%)
C2H2 Zn finger 184..204 CDD:275368 9/19 (47%)
zf-H2C2_2 197..219 CDD:290200 12/21 (57%)
C2H2 Zn finger 212..232 CDD:275368 9/19 (47%)
zf-H2C2_2 224..249 CDD:290200 13/24 (54%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-H2C2_2 252..276 CDD:290200 11/23 (48%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..341 CDD:275368 5/16 (31%)
ZNF79NP_009066.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
KRAB 40..98 CDD:214630
KRAB_A-box 40..77 CDD:143639
C2H2 Zn finger 172..189 CDD:275368
C2H2 Zn finger 195..215 CDD:275368 2/8 (25%)
COG5048 <206..437 CDD:227381 89/230 (39%)
zf-H2C2_2 207..232 CDD:290200 7/24 (29%)
C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
zf-H2C2_2 235..260 CDD:290200 7/24 (29%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
zf-H2C2_2 263..287 CDD:290200 11/23 (48%)
C2H2 Zn finger 279..299 CDD:275368 9/19 (47%)
zf-H2C2_2 291..316 CDD:290200 13/24 (54%)
C2H2 Zn finger 307..327 CDD:275368 9/19 (47%)
zf-H2C2_2 319..344 CDD:290200 13/24 (54%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
zf-H2C2_2 350..372 CDD:290200 12/21 (57%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
zf-H2C2_2 375..400 CDD:290200 10/24 (42%)
C2H2 Zn finger 391..411 CDD:275368 8/19 (42%)
zf-H2C2_2 403..427 CDD:290200 8/23 (35%)
C2H2 Zn finger 419..439 CDD:275368 6/20 (30%)
zf-H2C2_2 431..456 CDD:290200 5/10 (50%)
C2H2 Zn finger 447..467 CDD:275368
zf-H2C2_2 459..484 CDD:290200
C2H2 Zn finger 475..495 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.