DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF16

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001025147.2 Gene:ZNF16 / 7564 HGNCID:12947 Length:682 Species:Homo sapiens


Alignment Length:232 Identity:89/232 - (38%)
Similarity:132/232 - (56%) Gaps:8/232 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 GKSD--------SKKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHM 173
            |.||        |.:..:.|.||.|.:.:..:..:|.::||..:.:.|..|.:.||....|..|.
Human   276 GHSDFSRHQSHHSSERPYMCNECGKAFSQNSSLKKHQKSHMSEKPYECNECGKAFRRSSNLIQHQ 340

  Fly   174 KTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPF 238
            :.|:..|||.||.|.|.|.:.|.|..|.||||||:||:|.:|.|.|.:|:.||:|.|.|..|:|:
Human   341 RIHSGEKPYVCSECGKAFRRSSNLIKHHRTHTGEKPFECGECGKAFSQSAHLRKHQRVHTGEKPY 405

  Fly   239 KCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTF 303
            :|:.|.|.|:|..:|..|.|.||||:|:|||.|.|||:....|.||.|:|..::|..|:.|.|.|
Human   406 ECNDCGKPFSRVSNLIKHHRVHTGEKPYKCSDCGKAFSQSSSLIQHRRIHTGEKPHVCNVCGKAF 470

  Fly   304 RLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARH 340
            ..||.|::|:::|..|:.::|..|...:.....|.:|
Human   471 SYSSVLRKHQIIHTGEKPYRCSVCGKAFSHSSALIQH 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 5/19 (26%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 71/161 (44%)
C2H2 Zn finger 184..204 CDD:275368 9/19 (47%)
zf-H2C2_2 197..219 CDD:290200 13/21 (62%)
C2H2 Zn finger 212..232 CDD:275368 9/19 (47%)
zf-H2C2_2 224..249 CDD:290200 11/24 (46%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
zf-H2C2_2 252..276 CDD:290200 14/23 (61%)
C2H2 Zn finger 268..288 CDD:275368 10/19 (53%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..341 CDD:275368 4/17 (24%)
ZNF16NP_001025147.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Necessary for transcription activation 62..210
COG5048 <160..369 CDD:227381 29/92 (32%)
C2H2 Zn finger 187..203 CDD:275368
C2H2 Zn finger 211..231 CDD:275368
C2H2 Zn finger 239..259 CDD:275368
C2H2 Zn finger 267..287 CDD:275368 3/10 (30%)
Required for nuclear localization 268..393 42/116 (36%)
C2H2 Zn finger 295..315 CDD:275368 5/19 (26%)
COG5048 303..675 CDD:227381 81/205 (40%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
Required for nuclear localization 341..373 15/31 (48%)
C2H2 Zn finger 351..371 CDD:275368 9/19 (47%)
C2H2 Zn finger 379..399 CDD:275368 9/19 (47%)
C2H2 Zn finger 407..427 CDD:275368 8/19 (42%)
C2H2 Zn finger 435..455 CDD:275368 10/19 (53%)
C2H2 Zn finger 463..483 CDD:275368 8/19 (42%)
Required for nuclear localization 473..503 8/29 (28%)
C2H2 Zn finger 491..511 CDD:275368 4/17 (24%)
C2H2 Zn finger 519..539 CDD:275368
C2H2 Zn finger 547..567 CDD:275368
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 603..623 CDD:275368
C2H2 Zn finger 631..651 CDD:275368
C2H2 Zn finger 659..679 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.