DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF71

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001357144.1 Gene:ZNF71 / 58491 HGNCID:13141 Length:549 Species:Homo sapiens


Alignment Length:219 Identity:84/219 - (38%)
Similarity:122/219 - (55%) Gaps:0/219 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSH 186
            :|..::|.||.|.:.|..:.::|.|.|...:.|.|..|.::|..|.:|..|.:.|...|||.|..
Human   186 EKKTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDTCGKHFIERSSLTIHQRVHTGEKPYACGD 250

  Fly   187 CAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKF 251
            |.|.|:|:..|..|:||||||:|:.|..|.|.|.|:|.|.:|.|.|..|:|:.|..|.|.|::..
Human   251 CGKAFSQRMNLTVHQRTHTGEKPYVCDVCGKAFRKTSSLTQHERIHTGEKPYACGDCGKAFSQNM 315

  Fly   252 HLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVH 316
            ||..|.|:||||:|:.|..|.:||:...||.:|.|.|..::|:.|..|.|.|..||:|..|:..|
Human   316 HLIVHQRTHTGEKPYVCPECGRAFSQNMHLTEHQRTHTGEKPYACKECGKAFNKSSSLTLHQRNH 380

  Fly   317 NAERTFKCPHCASFYKQRKTLARH 340
            ..|:.:.|..|...:.|...|.:|
Human   381 TGEKPYVCGECGKAFSQSSYLIQH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 7/19 (37%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 67/161 (42%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 12/21 (57%)
C2H2 Zn finger 212..232 CDD:275368 9/19 (47%)
zf-H2C2_2 224..249 CDD:290200 10/24 (42%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
zf-H2C2_2 252..276 CDD:290200 12/23 (52%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..341 CDD:275368 5/17 (29%)
ZNF71NP_001357144.1 KRAB 13..54 CDD:334504
C2H2 Zn finger 168..184 CDD:275368
COG5048 170..544 CDD:227381 84/219 (38%)
C2H2 Zn finger 192..212 CDD:275368 7/19 (37%)
C2H2 Zn finger 220..240 CDD:275368 6/19 (32%)
C2H2 Zn finger 248..268 CDD:275368 8/19 (42%)
C2H2 Zn finger 276..296 CDD:275368 9/19 (47%)
C2H2 Zn finger 304..324 CDD:275368 8/19 (42%)
C2H2 Zn finger 332..352 CDD:275368 8/19 (42%)
C2H2 Zn finger 360..380 CDD:275368 8/19 (42%)
C2H2 Zn finger 388..408 CDD:275368 5/17 (29%)
C2H2 Zn finger 416..436 CDD:275368
C2H2 Zn finger 444..464 CDD:275368
C2H2 Zn finger 472..492 CDD:275368
C2H2 Zn finger 500..520 CDD:275368
C2H2 Zn finger 528..548 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.