DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF471

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_065864.2 Gene:ZNF471 / 57573 HGNCID:23226 Length:626 Species:Homo sapiens


Alignment Length:276 Identity:92/276 - (33%)
Similarity:141/276 - (51%) Gaps:30/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EEDWEISEDEDARIDSASAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQS-FPCP 157
            |:.:|..|...|..|.:|.|... :..:.|..:||.||.|.::...:|:||.|::..|:. |.|.
Human   315 EKPYECKECGKAFSDGSSFARHQ-RCHTGKRPYECIECGKAFRYNTSFIRHWRSYHTGEKPFNCI 378

  Fly   158 YCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKS 222
            .|.:.|.:.:.|..|.:.|...|||:|..|.|||:..|:...|:|.||||:|::|..|.|.|...
Human   379 DCGKAFSVHIGLILHRRIHTGEKPYKCGVCGKTFSSGSSRTVHQRIHTGEKPYECDICGKDFSHH 443

  Fly   223 SDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAF------------ 275
            :.|.:|.|.|..|:|::|.:|.|.|.:..||.:|.|.||||:|::|..|.|||            
Human   444 ASLTQHQRVHSGEKPYECKECGKAFRQNVHLVSHLRIHTGEKPYECKECGKAFRISSQLATHQRI 508

  Fly   276 --------------AMKQ--HLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERTFKC 324
                          |.||  ||.||.:.|..::|:.|:.|.|.|..:|.|.:|:.:|..|:.:||
Human   509 HTGEKPYECIECGNAFKQRSHLAQHQKTHTGEKPYECNECGKAFSQTSNLTQHQRIHTGEKPYKC 573

  Fly   325 PHCASFYKQRKTLARH 340
            ..|...:....:.|:|
Human   574 TECGKAFSDSSSCAQH 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 8/19 (42%)
C2H2 Zn finger 156..176 CDD:275368 5/19 (26%)
COG5048 <180..341 CDD:227381 67/189 (35%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 10/21 (48%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
zf-H2C2_2 224..249 CDD:290200 10/24 (42%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
zf-H2C2_2 252..276 CDD:290200 14/49 (29%)
C2H2 Zn finger 268..288 CDD:275368 12/47 (26%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
C2H2 Zn finger 324..341 CDD:275368 4/17 (24%)
ZNF471NP_065864.2 KRAB 14..73 CDD:214630
KRAB 14..53 CDD:279668
COG5048 203..610 CDD:227381 92/276 (33%)
C2H2 Zn finger 208..228 CDD:275368
zf-H2C2_2 220..245 CDD:290200
C2H2 Zn finger 236..256 CDD:275368
zf-H2C2_2 248..273 CDD:290200
C2H2 Zn finger 264..284 CDD:275368
zf-H2C2_2 276..301 CDD:290200
C2H2 Zn finger 292..312 CDD:275368
zf-H2C2_2 304..328 CDD:290200 4/12 (33%)
C2H2 Zn finger 320..340 CDD:275368 5/20 (25%)
zf-H2C2_2 332..357 CDD:290200 8/25 (32%)
C2H2 Zn finger 348..366 CDD:275368 7/17 (41%)
C2H2 Zn finger 377..397 CDD:275368 5/19 (26%)
zf-H2C2_2 393..414 CDD:290200 10/20 (50%)
C2H2 Zn finger 405..425 CDD:275368 8/19 (42%)
zf-H2C2_2 420..442 CDD:290200 11/21 (52%)
C2H2 Zn finger 433..453 CDD:275368 7/19 (37%)
zf-H2C2_2 445..470 CDD:290200 10/24 (42%)
C2H2 Zn finger 461..481 CDD:275368 8/19 (42%)
zf-H2C2_2 473..496 CDD:290200 12/22 (55%)
C2H2 Zn finger 489..509 CDD:275368 5/19 (26%)
zf-H2C2_2 502..526 CDD:290200 1/23 (4%)
C2H2 Zn finger 517..537 CDD:275368 7/19 (37%)
zf-H2C2_2 529..554 CDD:290200 10/24 (42%)
C2H2 Zn finger 545..565 CDD:275368 7/19 (37%)
zf-H2C2_2 557..581 CDD:290200 7/23 (30%)
C2H2 Zn finger 573..593 CDD:275368 4/17 (24%)
C2H2 Zn finger 601..621 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.