DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15436 and sens

DIOPT Version :9

Sequence 1:	NP_608840.1	Gene:	CG15436 / 33657	FlyBaseID:	FBgn0031610	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	NP_524818.1	Gene:	sens / 45328	FlyBaseID:	FBgn0002573	Length:	541	Species:	Drosophila melanogaster

Alignment Length:	131	Identity:	47/131 - (35%)
Similarity:	75/131 - (57%)	Gaps:	2/131 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   109 SASAADDDGKSDSKKVA--FECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKA 171
            |:|::...|:::.|:..  |:|::|.|.::|..|...|:..|.|.:.:||.||.:.|..:..:|.
  Fly   394 SSSSSSYQGENEEKRSGRNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKK 458

  Fly   172 HMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSER 236
            |...|...||::|:.|.|.|:|.|.|.:|.|.|||.:||.|..|.::|.:..|||||..:...|.
  Fly   459 HTYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESRHEEA 523

  Fly   237 P 237
            |
  Fly   524 P 524

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15436	NP_608840.1	zf-AD	4..78	CDD:285071
		C2H2 Zn finger	128..148	CDD:275368	6/19 (32%)
		C2H2 Zn finger	156..176	CDD:275368	6/19 (32%)
		COG5048	<180..341	CDD:227381	26/58 (45%)
		C2H2 Zn finger	184..204	CDD:275368	9/19 (47%)
		zf-H2C2_2	197..219	CDD:290200	10/21 (48%)
		C2H2 Zn finger	212..232	CDD:275368	8/19 (42%)
		zf-H2C2_2	224..249	CDD:290200	7/14 (50%)
		C2H2 Zn finger	240..260	CDD:275368
		zf-H2C2_2	252..276	CDD:290200
		C2H2 Zn finger	268..288	CDD:275368
		C2H2 Zn finger	296..316	CDD:275368
		C2H2 Zn finger	324..341	CDD:275368
sens	NP_524818.1	zf-C2H2	413..435	CDD:278523	7/21 (33%)
		C2H2 Zn finger	415..435	CDD:275368	6/19 (32%)
		COG5048	423..>497	CDD:227381	27/73 (37%)
		zf-H2C2_2	428..452	CDD:290200	8/23 (35%)
		C2H2 Zn finger	443..463	CDD:275368	6/19 (32%)
		zf-H2C2_2	455..480	CDD:290200	9/24 (38%)
		C2H2 Zn finger	471..491	CDD:275368	9/19 (47%)
		C2H2 Zn finger	499..516	CDD:275368	7/16 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100