DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF727

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001152994.1 Gene:ZNF727 / 442319 HGNCID:22785 Length:499 Species:Homo sapiens


Alignment Length:344 Identity:101/344 - (29%)
Similarity:152/344 - (44%) Gaps:63/344 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KSAY-GIRQTCEESHQFYCRVRDEGIEDALCALLEEEDWEISED---------EDARI------- 107
            ||:| ||.|....:....|:....|....||::..|.....|.:         :|.|:       
Human   127 KSSYNGIHQCLSATRSKTCQYNKCGKAFGLCSIFTEHKKIFSREKCYKCEECGKDCRLSDFTIQK 191

  Fly   108 -----DSASAADDDGKSDSK-------------KVAFECRECHKKYQRKGTFLRHMRTHMDGQSF 154
                 |.:...::.||:..|             |..::|.||.|.:.......:|.|.|...:.:
Human   192 RIHTADRSYKCEECGKACKKFSNLTEHNRVHTGKKPYKCEECGKTFTCSSALTKHKRNHTGDRPY 256

  Fly   155 PCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTF 219
            .|..|.:.||....|..|.:.|...|||:|..|.|.|...|.|..|:|.||||:|:||::|.|.|
Human   257 KCEECHKAFRCCSDLTKHKRIHTGEKPYKCKECHKAFRCCSDLTKHKRIHTGEKPYKCNECGKAF 321

  Fly   220 IKSSDLRRHIRTHGSERPFKCSKCTKTFT--------RKFHLD--------------------NH 256
            :..|.|.:|.|.|..|:|:.|.:|.|.||        ::.|::                    ||
Human   322 MWISALSQHNRIHTGEKPYICEECGKAFTYSSTLISHKRIHMELRPYKCEECGKTFKWFSDLTNH 386

  Fly   257 FRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERT 321
            .|.||||:|:||..|.|:|....:|.:|.|:|:..||::|..|.|||:....|..||.:|..|:.
Human   387 KRIHTGEKPYKCEECGKSFTCSSNLIKHKRIHMEVRPYKCEECGKTFKWFPDLTNHKRIHTGEKP 451

  Fly   322 FKCPHCASFYKQRKTLARH 340
            :||..|...:....:|.:|
Human   452 YKCEECGKTFTCSSSLIKH 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 6/18 (33%)
C2H2 Zn finger 128..148 CDD:275368 6/19 (32%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 68/189 (36%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 12/21 (57%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 11/32 (34%)
C2H2 Zn finger 240..260 CDD:275368 9/47 (19%)
zf-H2C2_2 252..276 CDD:290200 13/43 (30%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..341 CDD:275368 4/17 (24%)
ZNF727NP_001152994.1 KRAB 4..64 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 148..167 CDD:275370 4/18 (22%)
C2H2 Zn finger 175..194 CDD:275368 2/18 (11%)
C2H2 Zn finger 202..222 CDD:275368 3/19 (16%)
zf-H2C2_2 214..239 CDD:290200 5/24 (21%)
COG5048 <226..409 CDD:227381 61/182 (34%)
C2H2 Zn finger 230..250 CDD:275368 6/19 (32%)
zf-H2C2_2 242..267 CDD:290200 6/24 (25%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
zf-H2C2_2 270..295 CDD:290200 10/24 (42%)
C2H2 Zn finger 286..306 CDD:275368 8/19 (42%)
zf-H2C2_2 298..321 CDD:290200 12/22 (55%)
C2H2 Zn finger 314..334 CDD:275368 8/19 (42%)
zf-H2C2_2 326..351 CDD:290200 10/24 (42%)
C2H2 Zn finger 342..362 CDD:275368 5/19 (26%)
C2H2 Zn finger 370..390 CDD:275368 3/19 (16%)
zf-H2C2_2 382..407 CDD:290200 13/24 (54%)
C2H2 Zn finger 398..418 CDD:275368 7/19 (37%)
C2H2 Zn finger 426..446 CDD:275368 8/19 (42%)
zf-H2C2_2 438..463 CDD:290200 8/24 (33%)
C2H2 Zn finger 454..474 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.