| Sequence 1: | NP_608840.1 | Gene: | CG15436 / 33657 | FlyBaseID: | FBgn0031610 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650860.1 | Gene: | CG4854 / 42391 | FlyBaseID: | FBgn0038766 | Length: | 319 | Species: | Drosophila melanogaster |
| Alignment Length: | 325 | Identity: | 95/325 - (29%) |
|---|---|---|---|
| Similarity: | 134/325 - (41%) | Gaps: | 65/325 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 CRVCMDISGKLVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAYGIRQTC 69
Fly 70 EESHQFYCR----------VRDE------------------GIEDAL---------CALLEEEDW 97
Fly 98 EISEDEDARIDSASAADDDG--KSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQ--SFPCPY 158
Fly 159 CKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSS 223
Fly 224 DLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLH 288
Fly 289 288 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15436 | NP_608840.1 | zf-AD | 4..78 | CDD:285071 | 16/72 (22%) |
| C2H2 Zn finger | 128..148 | CDD:275368 | 0/19 (0%) | ||
| C2H2 Zn finger | 156..176 | CDD:275368 | 8/19 (42%) | ||
| COG5048 | <180..341 | CDD:227381 | 47/109 (43%) | ||
| C2H2 Zn finger | 184..204 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 197..219 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 212..232 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 224..249 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 240..260 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 252..276 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 296..316 | CDD:275368 | |||
| C2H2 Zn finger | 324..341 | CDD:275368 | |||
| CG4854 | NP_650860.1 | zf-AD | 12..>57 | CDD:285071 | 12/49 (24%) |
| C2H2 Zn finger | 180..200 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 193..217 | CDD:290200 | 13/23 (57%) | ||
| COG5048 | 201..>258 | CDD:227381 | 25/56 (45%) | ||
| C2H2 Zn finger | 208..228 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 221..244 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 236..256 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 251..273 | CDD:290200 | 10/21 (48%) | ||
| C2H2 Zn finger | 264..284 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 277..301 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 292..312 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 84 | 1.000 | Inparanoid score | I1804 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||