DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and CG4424

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:317 Identity:90/317 - (28%)
Similarity:140/317 - (44%) Gaps:61/317 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEICRVCM-DISGKLVNIF---DARRRTRVSIAEMIAQCTGFEVK---RGDLFSEMICPQCYED 58
            |..:||.|: |....:|:||   |.|....||:.:.|...:|.:::   :.::....||.:|...
  Fly     7 MMTLCRTCLQDGEAHMVSIFQTADDRLPGGVSLCDKIESLSGIQIRATAKEEVLPTRICLRCKAF 71

  Fly    59 VKSAYGIRQTCEESHQFYCRVRDEGIEDAL----------------CALLEEEDWEISEDEDARI 107
            :..|:..||.|:.|::|   :|:..|:||:                ...:|.|..|..|||....
  Fly    72 LTLAHKFRQICQRSNEF---LREYVIKDAVEQGVVKEVVQQTRPSTPPPIETEQLEPPEDEVLEE 133

  Fly   108 DSASAAD-----DDGKSDSKK---VAFE---------------------------CRECHKKYQR 137
            ...|..|     ..|.::.::   :..|                           |..|...|.|
  Fly   134 GVWSTEDPIEETPHGPAEKERPTVLTVEMLPAPYPPPASTPPPAPAGAVKGKLHVCAICGNGYPR 198

  Fly   138 KGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHER 202
            |.|...|||.|.|.:.:.|..|.::|.:...||.|::.|..||||.|.:|.:.||.:::|..|||
  Fly   199 KSTLDTHMRRHNDERPYECEICHKSFHVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHER 263

  Fly   203 THTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRS 259
            ||..|||:.|..|.|.|..:|.|:.|.:||..|:|..|..|.|:|.|..:|..|.::
  Fly   264 THRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAHLQT 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 22/80 (28%)
C2H2 Zn finger 128..148 CDD:275368 9/19 (47%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 34/80 (43%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 12/21 (57%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
zf-H2C2_2 224..249 CDD:290200 10/24 (42%)
C2H2 Zn finger 240..260 CDD:275368 7/20 (35%)
zf-H2C2_2 252..276 CDD:290200 2/8 (25%)
C2H2 Zn finger 268..288 CDD:275368
C2H2 Zn finger 296..316 CDD:275368
C2H2 Zn finger 324..341 CDD:275368
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 23/84 (27%)
C2H2 Zn finger 189..209 CDD:275368 9/19 (47%)
DUF45 <204..281 CDD:302795 32/76 (42%)
COG5048 210..>345 CDD:227381 43/111 (39%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 13/24 (54%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..320 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.