DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and CG14710

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:391 Identity:90/391 - (23%)
Similarity:139/391 - (35%) Gaps:119/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRVCM-DI-SGKLVNIF------DARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKS 61
            ||:|: |. ..:::.:|      |.|::..:        |....|::.....|..|..|.|.|:.
  Fly    10 CRICLGDFEESQMICLFGDKGESDLRKKLEL--------CCRIRVRQSPQLPEKACNSCCEFVQM 66

  Fly    62 AYGIRQTCEESHQF----------------------------YCRVRDEGIEDALCALLEEEDWE 98
            .:..||.|..|..:                            :.::..|..|......:||.|.:
  Fly    67 WFNFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEITAIEEGDEQ 131

  Fly    99 -------------------ISEDEDARIDS------------------ASAADDDG--------- 117
                               |.|||:...:|                  ....||.|         
  Fly   132 QEDQSQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQMEELIDDKGELVEELSNA 196

  Fly   118 -------------------------KSDSKKVAFECR-ECHKKYQRKGTFLRHMRTH---MDGQS 153
                                     |.|.:|.....: :...|::||....:.....   .:.:.
  Fly   197 NTFYEVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDINAKERGNQPKCKEEEK 261

  Fly   154 FPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKT 218
            |.|..|...|..:....|||.||:..||::|..|.|:|.|...|::|.|.|||:||:||..|.:.
  Fly   262 FMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRRHTGDRPYKCMYCDRH 326

  Fly   219 FIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQ 283
            |...|:..||.|.|.:.||:.|.:|.||||....|.||..||:.::.:.|..|.|:|.:...||.
  Fly   327 FYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKA 391

  Fly   284 H 284
            |
  Fly   392 H 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 18/108 (17%)
C2H2 Zn finger 128..148 CDD:275368 3/20 (15%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 44/105 (42%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 11/21 (52%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
zf-H2C2_2 224..249 CDD:290200 11/24 (46%)
C2H2 Zn finger 240..260 CDD:275368 9/19 (47%)
zf-H2C2_2 252..276 CDD:290200 8/23 (35%)
C2H2 Zn finger 268..288 CDD:275368 7/17 (41%)
C2H2 Zn finger 296..316 CDD:275368
C2H2 Zn finger 324..341 CDD:275368
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 18/80 (23%)
COG5048 <261..395 CDD:227381 53/132 (40%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 8/21 (38%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 304..327 CDD:290200 11/22 (50%)
C2H2 Zn finger 320..340 CDD:275368 7/19 (37%)
zf-H2C2_2 335..357 CDD:290200 11/21 (52%)
C2H2 Zn finger 348..368 CDD:275368 9/19 (47%)
C2H2 Zn finger 376..395 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.