DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and CG8159

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster


Alignment Length:373 Identity:98/373 - (26%)
Similarity:158/373 - (42%) Gaps:91/373 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEICRVCMDI--SGKLVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAY 63
            :..:||||...  :.|.:.:|::   ....:.:.|...||..::......:.:|..|..|:|||.
  Fly     2 LQNVCRVCASSTDNSKSLKLFNS---GACKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAI 63

  Fly    64 GIRQTCEESHQFY--CRVRDEGIEDA---------------------------LCALLEEEDWEI 99
            ..|..|..|.:.:  ..||:|  ||.                           |..:::.|....
  Fly    64 SFRDRCLRSQKIFEESLVRNE--EDTFRSSVRRSARSQRQRHEDTAPKTPASPLEVMIKLESLSN 126

  Fly   100 SEDEDARID----------------SASAADDDGKSDSKKVAFECRECHKKYQRKGTFLR----- 143
            .::||..||                .:|:.:|||.:...::        |:.:|:|  |:     
  Fly   127 GDEEDDGIDHLDSCNEADMELAIKAMSSSTEDDGTTSPVRL--------KRTRRRG--LKKGGKG 181

  Fly   144 HMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGER 208
            ..||.:....|.|..|..|...:.:...|::.|:..:|::|..|...|.....|:.|:..|||:|
  Fly   182 ENRTKVTLPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQVMHTGDR 246

  Fly   209 PFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPK 273
            .|:|..|.:|::..|...||.|||.::|||.|::|.|:||..:.|.||...|||||.|:|..|.:
  Fly   247 KFQCRYCDRTYVNYSGRLRHERTHTNDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHR 311

  Fly   274 AFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERT 321
            :||...|||.|.|                   |:|   ||  ||.|::
  Fly   312 SFARPTHLKTHFR-------------------SNT---HK--HNLEKS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 18/77 (23%)
C2H2 Zn finger 128..148 CDD:275368 5/24 (21%)
C2H2 Zn finger 156..176 CDD:275368 4/19 (21%)
COG5048 <180..341 CDD:227381 53/142 (37%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
zf-H2C2_2 197..219 CDD:290200 9/21 (43%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
zf-H2C2_2 224..249 CDD:290200 12/24 (50%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
zf-H2C2_2 252..276 CDD:290200 11/23 (48%)
C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
C2H2 Zn finger 296..316 CDD:275368 4/19 (21%)
C2H2 Zn finger 324..341 CDD:275368
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 18/75 (24%)
C2H2 Zn finger 194..214 CDD:275368 4/19 (21%)
COG5048 <197..322 CDD:227381 48/124 (39%)
zf-H2C2_2 206..231 CDD:290200 6/24 (25%)
C2H2 Zn finger 222..242 CDD:275368 5/19 (26%)
C2H2 Zn finger 250..270 CDD:275368 7/19 (37%)
zf-H2C2_2 265..287 CDD:290200 12/21 (57%)
C2H2 Zn finger 278..298 CDD:275368 8/19 (42%)
zf-H2C2_2 291..315 CDD:290200 12/23 (52%)
C2H2 Zn finger 306..328 CDD:275368 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1804
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.