DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and CG14655

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:255 Identity:71/255 - (27%)
Similarity:106/255 - (41%) Gaps:67/255 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FECRECHKKYQRKGTFLRHMR-THMDGQSFPC-----------------------PYCKRNFRLR 166
            ::|..|.|.::.||:...|:: .||.|  .||                       |......|:|
  Fly   157 YKCHLCSKTFRMKGSLRIHLKVVHMMG--VPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIR 219

  Fly   167 VTL-----KAHMKTHNAAKPY--------------------------ECSHCAKTFAQQSTLQSH 200
            .|.     ..:..|..|::||                          ||..|:|:|..:..|:.|
  Fly   220 HTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKH 284

  Fly   201 ERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERP 265
            :|.||||.|:.|..|::||.......:|:..|...:|..|..|.:.|.....|.||.|.|:||:|
  Fly   285 KRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKP 349

  Fly   266 FKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERTFKCP 325
            |||..|.|.|..:.....|:|:|....|::|..|.||||       :|:   ::||.:||
  Fly   350 FKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTFR-------YKV---SQRTHRCP 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 6/20 (30%)
C2H2 Zn finger 156..176 CDD:275368 5/47 (11%)
COG5048 <180..341 CDD:227381 54/172 (31%)
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
zf-H2C2_2 197..219 CDD:290200 10/21 (48%)
C2H2 Zn finger 212..232 CDD:275368 5/19 (26%)
zf-H2C2_2 224..249 CDD:290200 6/24 (25%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-H2C2_2 252..276 CDD:290200 13/23 (57%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
C2H2 Zn finger 324..341 CDD:275368 2/2 (100%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 281..304 CDD:290200 11/22 (50%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 339..361 CDD:290200 13/21 (62%)
C2H2 Zn finger 352..372 CDD:275368 6/19 (32%)
zf-H2C2_2 364..389 CDD:290200 10/31 (32%)
C2H2 Zn finger 380..396 CDD:275368 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.