DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF888

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_016882287.1 Gene:ZNF888 / 388559 HGNCID:38695 Length:830 Species:Homo sapiens


Alignment Length:215 Identity:91/215 - (42%)
Similarity:132/215 - (61%) Gaps:0/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKT 190
            ::|:||.|.:.||....||.|.|...:.:.|..|.:.||....|..|:..|...|||:|:.|.||
Human   466 YQCKECDKVFSRKSYLERHRRIHTGEKPYKCKVCDKAFRHDSHLAQHIVIHTREKPYKCNECGKT 530

  Fly   191 FAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDN 255
            |.:.|.|..|:..||||:|:||::|.|.|.:.|:|.||.|.|..|:|:||.:|.|.|:||.||:.
Human   531 FGENSALLVHKTIHTGEKPYKCNECGKVFNQQSNLARHHRLHTGEKPYKCKECDKVFSRKSHLER 595

  Fly   256 HFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAER 320
            |.|.||||:|:||..|.|||....||.||:.:|..::|::|:.|.|||..:|:|..||::|..|:
Human   596 HRRIHTGEKPYKCKVCDKAFRRDSHLAQHTVIHTGEKPYKCNECGKTFVQNSSLVMHKVIHTGEK 660

  Fly   321 TFKCPHCASFYKQRKTLARH 340
            .:||..|...:..:.:||.|
Human   661 RYKCNECGKSFNHKSSLAYH 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 9/19 (47%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 74/161 (46%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 11/21 (52%)
C2H2 Zn finger 212..232 CDD:275368 9/19 (47%)
zf-H2C2_2 224..249 CDD:290200 12/24 (50%)
C2H2 Zn finger 240..260 CDD:275368 10/19 (53%)
zf-H2C2_2 252..276 CDD:290200 14/23 (61%)
C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
C2H2 Zn finger 296..316 CDD:275368 9/19 (47%)
C2H2 Zn finger 324..341 CDD:275368 5/17 (29%)
ZNF888XP_016882287.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.