DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and D19A

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster


Alignment Length:537 Identity:120/537 - (22%)
Similarity:182/537 - (33%) Gaps:202/537 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICRVCMDISGKLVNIFDARRRTRV--SIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAYGIR 66
            :||:|::   .|.|  ||.....:  .:::.:..||...|::.|.|.:.:|..||..:...:..:
  Fly    12 LCRICLN---HLQN--DAAYDLYLVPGLSKKLCFCTSLSVEQNDGFPKNLCTLCYTKLNELHDFQ 71

  Fly    67 QTCEESHQ----------FYCR-----------VRD----------------------EGIEDAL 88
            :.|.:|.|          |.|:           |:|                      |..||..
  Fly    72 KQCVDSVQKFQDLVASNVFACQSSFDVFDPNVAVQDYPAEEEDHVNYDPLLNHKMELIENEEDVF 136

  Fly    89 CALLEEEDWEISE--------------------DEDARI-------------------------- 107
             .:||..|.|..|                    |:|:.|                          
  Fly   137 -KMLEHVDKEAEEVEKEAKVEEDDGGNVSVKMFDDDSSIESGNDNDHDLDFEPNSSDDDIPLAQR 200

  Fly   108 -------------------------------------------DSASAADD--DG-----KSDSK 122
                                                       ||:|.:||  ||     |...|
  Fly   201 MRGPATGSGPQQDRFSNLDKPKPRPRGRPKKIKPPPPEEEELSDSSSESDDSEDGTSRGDKPKRK 265

  Fly   123 KVAFE---------CRECHKKYQRKGTFLRHMRTHMDGQSFPCPY--CKRNF------------- 163
            ::..|         |..||:|:::...:..||:.|.|...|.|..  ||:.|             
  Fly   266 RIPIEERHLHRIIDCHICHQKFKKAIRYEEHMKYHNDLLPFQCKVETCKKGFTTANGLRIHIDHA 330

  Fly   164 --------------------RLRVTLKAHM-KTH---NAAKP---YECSHCAKTFAQQSTLQSHE 201
                                |:|: |..|| |.|   .||.|   :.|:.|...|...:.|:.|.
  Fly   331 HTELSEVHACIAEGCGKTFPRVRL-LTFHMKKVHGITKAAAPLRDFPCTECDTVFRCPTALKKHM 394

  Fly   202 RTHTGER-PFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERP 265
            ..||||. |:.|:.|.|.|:.:|.||.|:..|...:...|..|....|.:...:.|..:||.|:.
  Fly   395 YKHTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYCGVGKTTRQEWNAHILTHTKEKK 459

  Fly   266 FKCSHCPKAFAMKQHLKQHSR-LHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERTFKCPHCAS 329
            |||..|..|...||.|..|.: :|...:.|.|.:|.|||..|...|.|:..|..|:..:|..|..
  Fly   460 FKCRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFGKSHACKVHERSHTGEKCCECKICGK 524

  Fly   330 FYKQRKTLARHILEIHK 346
            .:...|:|.:| |:.|:
  Fly   525 IFLCEKSLTKH-LKTHE 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 19/85 (22%)
C2H2 Zn finger 128..148 CDD:275368 6/19 (32%)
C2H2 Zn finger 156..176 CDD:275368 10/55 (18%)
COG5048 <180..341 CDD:227381 52/165 (32%)
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
zf-H2C2_2 197..219 CDD:290200 10/22 (45%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 6/24 (25%)
C2H2 Zn finger 240..260 CDD:275368 4/19 (21%)
zf-H2C2_2 252..276 CDD:290200 9/23 (39%)
C2H2 Zn finger 268..288 CDD:275368 7/20 (35%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..341 CDD:275368 4/16 (25%)
D19ANP_477304.1 zf-AD 12..83 CDD:214871 18/75 (24%)
C2H2 Zn finger 343..362 CDD:275368 5/19 (26%)
C2H2 Zn finger 377..397 CDD:275368 5/19 (26%)
zf-H2C2_2 389..414 CDD:290200 10/24 (42%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
C2H2 Zn finger 434..454 CDD:275368 4/19 (21%)
C2H2 Zn finger 462..483 CDD:275368 7/20 (35%)
C2H2 Zn finger 491..511 CDD:275368 8/19 (42%)
C2H2 Zn finger 519..539 CDD:275368 6/20 (30%)
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.