DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and CG17385

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster


Alignment Length:222 Identity:71/222 - (31%)
Similarity:104/222 - (46%) Gaps:29/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 FPCPYCKRNFRLRVTLKAH-MKTHNAAK-PYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCS 216
            |.|..|.|.||.:.....| .:.||..| .|||..|||:|.....|..|.:.|...|||.|:.||
  Fly    16 FSCKRCDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICS 80

  Fly   217 KTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHL 281
            |.|.::.:|:||...|..||||.|:.|.|:||::.::..|..:||||:||:|..|.:.|:...:|
  Fly    81 KAFAQAVNLQRHYAVHSGERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNL 145

  Fly   282 KQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERT------------------------- 321
            |:|...||..:|::|::|.|.|...|..|.|...|..|..                         
  Fly   146 KKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGVDVDVPASIQAAAALARERLESEQKP 210

  Fly   322 --FKCPHCASFYKQRKTLARHILEIHK 346
              |:|..|.:.:.......:|..:.|:
  Fly   211 SFFECMVCRAIFDTFADYEKHEAKCHE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368
C2H2 Zn finger 156..176 CDD:275368 6/20 (30%)
COG5048 <180..341 CDD:227381 60/188 (32%)
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
zf-H2C2_2 197..219 CDD:290200 10/21 (48%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 12/24 (50%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-H2C2_2 252..276 CDD:290200 9/23 (39%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
C2H2 Zn finger 324..341 CDD:275368 2/16 (13%)
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 64/164 (39%)
C2H2 Zn finger 18..39 CDD:275368 6/20 (30%)
C2H2 Zn finger 48..68 CDD:275368 7/19 (37%)
C2H2 Zn finger 76..96 CDD:275368 8/19 (42%)
C2H2 Zn finger 104..124 CDD:275368 6/19 (32%)
C2H2 Zn finger 132..148 CDD:275368 5/15 (33%)
C2H2 Zn finger 160..180 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.