Sequence 1: | NP_608840.1 | Gene: | CG15436 / 33657 | FlyBaseID: | FBgn0031610 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
Alignment Length: | 222 | Identity: | 71/222 - (31%) |
---|---|---|---|
Similarity: | 104/222 - (46%) | Gaps: | 29/222 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 154 FPCPYCKRNFRLRVTLKAH-MKTHNAAK-PYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCS 216
Fly 217 KTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHL 281
Fly 282 KQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERT------------------------- 321
Fly 322 --FKCPHCASFYKQRKTLARHILEIHK 346 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15436 | NP_608840.1 | zf-AD | 4..78 | CDD:285071 | |
C2H2 Zn finger | 128..148 | CDD:275368 | |||
C2H2 Zn finger | 156..176 | CDD:275368 | 6/20 (30%) | ||
COG5048 | <180..341 | CDD:227381 | 60/188 (32%) | ||
C2H2 Zn finger | 184..204 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 197..219 | CDD:290200 | 10/21 (48%) | ||
C2H2 Zn finger | 212..232 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 224..249 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 240..260 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 252..276 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 268..288 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 296..316 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 324..341 | CDD:275368 | 2/16 (13%) | ||
CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 64/164 (39%) |
C2H2 Zn finger | 18..39 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 48..68 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 76..96 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 104..124 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 132..148 | CDD:275368 | 5/15 (33%) | ||
C2H2 Zn finger | 160..180 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45446539 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |