DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF680

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_848653.2 Gene:ZNF680 / 340252 HGNCID:26897 Length:530 Species:Homo sapiens


Alignment Length:215 Identity:82/215 - (38%)
Similarity:122/215 - (56%) Gaps:0/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKT 190
            ::|.||.|.:.:..|.::|.:.|::.:.|.|..|.:.|.|...|..|...|...|||:|..|.|.
Human   238 YKCEECGKAFNQSSTLIKHKKIHIEEKPFKCEECGKAFSLFSILSKHKIIHTGDKPYKCDECHKA 302

  Fly   191 FAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDN 255
            |...:||.:|:|.||||:||||.:|.|.|.:.|:|.:|.:.|..|:|:||.:|.|.|.:..:|..
Human   303 FNWFATLTNHKRIHTGEKPFKCEECGKDFNQFSNLTKHKKIHTGEKPYKCEECGKAFNQFANLTR 367

  Fly   256 HFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAER 320
            |.:.||||:.:||..|.|||....:|.:|.|:|..::|::|..|.|.|...|:|..||.:|..|.
Human   368 HKKIHTGEKSYKCEECGKAFIQSSNLTEHMRIHTGEKPYKCEECGKAFNGCSSLTRHKRIHTREN 432

  Fly   321 TFKCPHCASFYKQRKTLARH 340
            |:||..|...:....||..|
Human   433 TYKCEECGKGFTLFSTLTNH 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 6/19 (32%)
C2H2 Zn finger 156..176 CDD:275368 6/19 (32%)
COG5048 <180..341 CDD:227381 67/161 (42%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 13/21 (62%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
zf-H2C2_2 224..249 CDD:290200 10/24 (42%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-H2C2_2 252..276 CDD:290200 11/23 (48%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..341 CDD:275368 5/17 (29%)
ZNF680NP_848653.2 KRAB 13..73 CDD:214630
KRAB 13..52 CDD:279668
COG5048 152..513 CDD:227381 82/215 (38%)
zf-C2H2 182..204 CDD:278523
C2H2 Zn finger 184..204 CDD:275368
C2H2 Zn finger 212..232 CDD:275368
zf-H2C2_2 224..249 CDD:290200 4/10 (40%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
zf-H2C2_2 253..276 CDD:290200 5/22 (23%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
zf-H2C2_2 281..304 CDD:290200 9/22 (41%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
zf-H2C2_2 309..333 CDD:290200 14/23 (61%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 336..361 CDD:290200 10/24 (42%)
C2H2 Zn finger 352..372 CDD:275368 6/19 (32%)
zf-H2C2_2 364..389 CDD:290200 12/24 (50%)
C2H2 Zn finger 380..400 CDD:275368 8/19 (42%)
zf-H2C2_2 392..416 CDD:290200 8/23 (35%)
C2H2 Zn finger 408..428 CDD:275368 8/19 (42%)
C2H2 Zn finger 436..456 CDD:275368 5/17 (29%)
C2H2 Zn finger 464..484 CDD:275368
zf-H2C2_2 477..501 CDD:290200
zf-C2H2 490..512 CDD:278523
C2H2 Zn finger 492..512 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.