DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and ZNF678

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_848644.2 Gene:ZNF678 / 339500 HGNCID:28652 Length:580 Species:Homo sapiens


Alignment Length:215 Identity:84/215 - (39%)
Similarity:119/215 - (55%) Gaps:0/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKT 190
            ::|.||...:.......||.|.|...:.:.|..|.:.|....:|..|.:.|...|||:|..|.||
Human   320 YKCEECGNVFNECSHLTRHRRIHTGEKPYKCEECGKAFTQFASLTRHKRIHTGEKPYQCEECGKT 384

  Fly   191 FAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDN 255
            |.:.|.|.||:|.||||:|:||.:|.:||.:.|:|.:|.|.|..|:|:||.:|.|.|.:...|..
Human   385 FNRCSHLSSHKRIHTGEKPYKCEECGRTFTQFSNLTQHKRIHTGEKPYKCKECGKAFNKFSSLTQ 449

  Fly   256 HFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAER 320
            |.|.|||.:|:||..|.|.|....||..|.|:|..::|::|..|.|.|..||.|.:||.:|..|:
Human   450 HRRIHTGVKPYKCEECGKVFKQCSHLTSHKRIHTGEKPYKCKECGKAFYQSSILSKHKRIHTEEK 514

  Fly   321 TFKCPHCASFYKQRKTLARH 340
            .:||..|...:.|..:|.||
Human   515 PYKCEECGKAFNQFSSLTRH 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 6/19 (32%)
C2H2 Zn finger 156..176 CDD:275368 5/19 (26%)
COG5048 <180..341 CDD:227381 71/161 (44%)
C2H2 Zn finger 184..204 CDD:275368 10/19 (53%)
zf-H2C2_2 197..219 CDD:290200 12/21 (57%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 11/24 (46%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-H2C2_2 252..276 CDD:290200 11/23 (48%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 9/19 (47%)
C2H2 Zn finger 324..341 CDD:275368 6/17 (35%)
ZNF678NP_848644.2 KRAB 44..101 CDD:214630
KRAB 44..83 CDD:279668
COG5048 138..536 CDD:227381 84/215 (39%)
C2H2 Zn finger 154..174 CDD:275368
zf-H2C2_2 167..191 CDD:290200
C2H2 Zn finger 182..202 CDD:275368
zf-H2C2_2 194..218 CDD:290200
C2H2 Zn finger 210..230 CDD:275368
zf-H2C2_2 223..246 CDD:290200
C2H2 Zn finger 238..258 CDD:275368
zf-H2C2_2 251..275 CDD:290200
C2H2 Zn finger 266..286 CDD:275368
zf-H2C2_2 278..302 CDD:290200
C2H2 Zn finger 294..314 CDD:275368
zf-H2C2_2 306..330 CDD:290200 3/9 (33%)
C2H2 Zn finger 322..342 CDD:275368 6/19 (32%)
zf-H2C2_2 334..359 CDD:290200 7/24 (29%)
C2H2 Zn finger 350..370 CDD:275368 5/19 (26%)
zf-H2C2_2 362..387 CDD:290200 11/24 (46%)
C2H2 Zn finger 378..398 CDD:275368 10/19 (53%)
zf-H2C2_2 390..415 CDD:290200 14/24 (58%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
zf-H2C2_2 418..442 CDD:290200 10/23 (43%)
C2H2 Zn finger 434..454 CDD:275368 7/19 (37%)
zf-H2C2_2 446..471 CDD:290200 12/24 (50%)
C2H2 Zn finger 462..482 CDD:275368 8/19 (42%)
zf-H2C2_2 474..497 CDD:290200 9/22 (41%)
C2H2 Zn finger 490..510 CDD:275368 9/19 (47%)
zf-H2C2_2 503..527 CDD:290200 8/23 (35%)
C2H2 Zn finger 518..538 CDD:275368 6/17 (35%)
zf-H2C2_2 530..553 CDD:290200 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.