DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and CG11695

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:501 Identity:107/501 - (21%)
Similarity:172/501 - (34%) Gaps:164/501 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ICRVCMDISGKLVNIFD----ARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYED------ 58
            |||:|:|.:...|.|||    ..:....::||:|.:.....:...|..|:.:|.||::.      
  Fly     2 ICRLCLDDAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLADFEQ 66

  Fly    59 -----VKSAYGIRQ----------TCEESHQFYCRVRDEGIEDALCALLEEEDWEISEDEDARID 108
                 :|...|::|          ..:...|..|   :..|:.:..|...||..||  |.||..:
  Fly    67 FCAMVMKKQLGLQQLKMEPFSEDEDADTKAQILC---EPEIDVSPAAADNEECNEI--DGDASSN 126

  Fly   109 SASA----------------------------------------------ADDD----GKSDSKK 123
            |.|:                                              ||:|    |:.|.:.
  Fly   127 SRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDAEGEGDPES 191

  Fly   124 VAFECRE--------------------------------------------CHKKYQRKGTFLRH 144
            .:...||                                            |.::|:::..::.|
  Fly   192 RSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKKRALYVDH 256

  Fly   145 MRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAK---PYECSHCAKTFAQQSTLQSHERTHTG 206
            :..|.|...|.|..|.:....|::...||...:..|   .:.|..|:|.|::|..|..|.|.|..
  Fly   257 LHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTIHSRVHQQ 321

  Fly   207 ERPFKCSQCSKTFIKSSDLRRHI-RTHG-SERPFKCSKCTKTFTRKFHL---------------- 253
            ||..:|..|.::|..:.|||.|: |||. :..||.|..|...|..|.:|                
  Fly   322 ERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPE 386

  Fly   254 ------------DNHFRSH-------TGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHC 299
                        :|..|.|       ...|.:||..|......:..|..|.|.|.|....:|:||
  Fly   387 VQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHC 451

  Fly   300 PKTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIH 345
            .|.|:.|.:|:||...|..:..::|..|...:|....:.:|..::|
  Fly   452 AKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKHRRQMH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 21/98 (21%)
C2H2 Zn finger 128..148 CDD:275368 5/63 (8%)
C2H2 Zn finger 156..176 CDD:275368 5/19 (26%)
COG5048 <180..341 CDD:227381 54/200 (27%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 8/21 (38%)
C2H2 Zn finger 212..232 CDD:275368 8/20 (40%)
zf-H2C2_2 224..249 CDD:290200 12/26 (46%)
C2H2 Zn finger 240..260 CDD:275368 7/47 (15%)
zf-H2C2_2 252..276 CDD:290200 8/58 (14%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 296..316 CDD:275368 9/19 (47%)
C2H2 Zn finger 324..341 CDD:275368 3/16 (19%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 19/78 (24%)
C2H2 Zn finger 268..289 CDD:275368 5/20 (25%)
C2H2 Zn finger 299..319 CDD:275368 8/19 (42%)
C2H2 Zn finger 327..348 CDD:275368 8/20 (40%)
C2H2 Zn finger 357..376 CDD:275368 5/18 (28%)
C2H2 Zn finger 389..409 CDD:275368 3/19 (16%)
C2H2 Zn finger 420..440 CDD:275368 5/19 (26%)
C2H2 Zn finger 448..468 CDD:275368 9/19 (47%)
C2H2 Zn finger 476..494 CDD:275368 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.