DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and CG11696

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:300 Identity:78/300 - (26%)
Similarity:124/300 - (41%) Gaps:53/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 ISEDED-----ARIDSA-SAADDDGKSDSK---KVAFEC----RECHKKYQRKGTFLRHMRTHMD 150
            |.|.:|     .::|.| .||..:..:|.|   :|..:|    :.|:.:|:::..::.|:..|.|
  Fly   287 IKEMDDYIAANVKLDCAICAAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKD 351

  Fly   151 GQSFPCPYCKRNFRLRVTLKAHM-KTHNAAKP--YECSHCAKTFAQQSTLQSHERTHTG-ERPFK 211
            .|.|.|..|::||..|.:...|| :.|:..:.  ::|:.|...||::..|..|.:.|.| |||..
  Fly   352 PQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEV 416

  Fly   212 CSQCSKTFIKSSDLRRHI-RTHGSE-RPFKCSKCTKTFTRK---------FHLD----------- 254
            |..|||||....:|..|: |.|.:: .|..|..|...|..|         .|.|           
  Fly   417 CDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLC 481

  Fly   255 -----------NHFRSH---TGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRL 305
                       .|...|   .|:..::|..|....:.:..|..|.|.|...:..:||.|.|.|:|
  Fly   482 GRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKL 546

  Fly   306 SSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIH 345
            ...|.||...|.....::|..|...:|....:..|..::|
  Fly   547 PRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNHKKKMH 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 4/23 (17%)
C2H2 Zn finger 156..176 CDD:275368 7/20 (35%)
COG5048 <180..341 CDD:227381 50/199 (25%)
C2H2 Zn finger 184..204 CDD:275368 6/19 (32%)
zf-H2C2_2 197..219 CDD:290200 11/22 (50%)
C2H2 Zn finger 212..232 CDD:275368 9/20 (45%)
zf-H2C2_2 224..249 CDD:290200 8/26 (31%)
C2H2 Zn finger 240..260 CDD:275368 7/50 (14%)
zf-H2C2_2 252..276 CDD:290200 7/48 (15%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 296..316 CDD:275368 9/19 (47%)
C2H2 Zn finger 324..341 CDD:275368 3/16 (19%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 3/16 (19%)
C2H2 Zn finger 357..378 CDD:275368 7/20 (35%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 9/20 (45%)
C2H2 Zn finger 447..465 CDD:275368 4/17 (24%)
C2H2 Zn finger 478..498 CDD:275368 1/19 (5%)
C2H2 Zn finger 509..529 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368 9/19 (47%)
C2H2 Zn finger 565..583 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.