DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and CG2202

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster


Alignment Length:414 Identity:103/414 - (24%)
Similarity:167/414 - (40%) Gaps:127/414 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DVKSAYGIRQTCEESH------QFYCRVRDE----------GIEDAL-------CALLEEE---- 95
            :.::...|.:|.:..|      ||..:..::          |:||.:       ..|.:||    
  Fly   348 EAQAETSIDRTVKNEHIAIGDSQFSIKEENQLVGSDDEAPMGVEDFMKLHVSGELPLSDEERFDG 412

  Fly    96 ----DWEISEDEDARIDSASAADDDGKSDSKKVAFE---------------------------CR 129
                |.::.:|:|...:..:..||||:...|:...:                           |.
  Fly   413 FADDDSDLDDDDDDDDEEDAGDDDDGEFRLKQEPLDGEKPLKKAKSGRRRRRRNKDEPNPDNRCE 477

  Fly   130 ECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECS--------- 185
            .|.:.:.|....|||..:|::.:...||:|.:.|.....||||:::.::.|.::||         
  Fly   478 VCQRTFSRHCHLLRHKLSHLEKKPHNCPHCPKAFARSDHLKAHVQSLHSNKEHKCSLCEAAFSRL 542

  Fly   186 --------------------------------HCAK---------------------------TF 191
                                            :|:|                           ||
  Fly   543 DALERHKVSKHNGEGLEPGSELKLQLAEHTCEYCSKRFSSKTYLRKHTLLHTDFLYACKTCDETF 607

  Fly   192 AQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNH 256
            .:::.|:.||:||||:|.|.|..|..:|.::..||.|:|.|..|:|:||..|.|.|.|...|..|
  Fly   608 RERAQLREHEKTHTGQRNFLCCICGDSFARNDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKVH 672

  Fly   257 FRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERT 321
            .|.|||.:|..|:.|.|:|....:|..|.|.|..:||::|..|||:|..|:.||.|...|..|| 
  Fly   673 ERYHTGTKPNLCNTCGKSFHRAYNLTIHMRTHTGERPYKCDQCPKSFTQSNDLKAHIRRHTGER- 736

  Fly   322 FKCPHCASFYKQRKTLARHILEIH 345
            :|||||.:::.|...:..|.:..|
  Fly   737 YKCPHCDAYFLQLYNMRNHCMSAH 760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 5/25 (20%)
C2H2 Zn finger 128..148 CDD:275368 6/19 (32%)
C2H2 Zn finger 156..176 CDD:275368 8/19 (42%)
COG5048 <180..341 CDD:227381 67/228 (29%)
C2H2 Zn finger 184..204 CDD:275368 9/87 (10%)
zf-H2C2_2 197..219 CDD:290200 11/21 (52%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
zf-H2C2_2 224..249 CDD:290200 12/24 (50%)
C2H2 Zn finger 240..260 CDD:275368 8/19 (42%)
zf-H2C2_2 252..276 CDD:290200 10/23 (43%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 296..316 CDD:275368 9/19 (47%)
C2H2 Zn finger 324..341 CDD:275368 5/16 (31%)
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 74/286 (26%)
C2H2 Zn finger 476..496 CDD:275368 6/19 (32%)
zf-H2C2_2 488..513 CDD:290200 8/24 (33%)
C2H2 Zn finger 504..525 CDD:275368 8/20 (40%)
C2H2 Zn finger 532..548 CDD:275368 2/15 (13%)
C2H2 Zn finger 573..593 CDD:275368 2/19 (11%)
C2H2 Zn finger 600..620 CDD:275368 5/19 (26%)
zf-H2C2_2 613..637 CDD:290200 12/23 (52%)
C2H2 Zn finger 628..648 CDD:275368 7/19 (37%)
zf-H2C2_2 640..663 CDD:290200 11/22 (50%)
C2H2 Zn finger 656..676 CDD:275368 8/19 (42%)
C2H2 Zn finger 684..704 CDD:275368 7/19 (37%)
zf-C2H2 684..704 CDD:278523 7/19 (37%)
zf-H2C2_2 696..721 CDD:290200 11/24 (46%)
C2H2 Zn finger 712..732 CDD:275368 9/19 (47%)
C2H2 Zn finger 739..755 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D42822at6656
OrthoFinder 1 1.000 - - FOG0006715
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.