DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15436 and Zfp819

DIOPT Version :9

Sequence 1:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001014039.1 Gene:Zfp819 / 308561 RGDID:1309564 Length:614 Species:Rattus norvegicus


Alignment Length:323 Identity:100/323 - (30%)
Similarity:150/323 - (46%) Gaps:59/323 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CRVRDEGIEDALCA-----------------------------LLEEEDWEISEDEDARIDSASA 112
            ||:..:|:..|:|.                             |.::|..|.::||.|....:::
  Rat   227 CRLCTQGLSSAVCTTHSTGERACTGNQCANVLSPRSPLRQHGILSQDEPVEYTKDEKAFTAGSAS 291

  Fly   113 ADDD----------------GKS-------------DSKKVAFECRECHKKYQRKGTFLR-HMRT 147
            .:..                |||             ..::..:||.:|.|......:.|: |...
  Rat   292 CEQQTTNTLDLETHFICHICGKSFLQKSELSFHPGTSREETRYECPDCLKSLTTSPSSLQAHHEA 356

  Fly   148 HMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKC 212
            |...:.:.|..|.::|.....||.|::.|...:||.||.|.|.|:|:|.|.:|:|.||||:|:.|
  Rat   357 HTKQKPYTCHDCGKSFSYASHLKVHLRIHTGERPYVCSDCGKAFSQKSVLTTHQRIHTGEKPYAC 421

  Fly   213 SQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAM 277
            |.|.|.|:.:||||:|.|.|..|:|::|..|.|.|:.|.||..|.|.||||:|:||..|.|:|..
  Rat   422 SHCGKLFVYASDLRKHSRFHTGEKPYECRDCGKVFSNKSHLPVHRRIHTGEKPYKCRDCGKSFRR 486

  Fly   278 KQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARH 340
            |.||:.|.|.|..::|:.|..|.|.|..||.|..|:.:|..||.:.|..|......:..|:.|
  Rat   487 KSHLQVHGRTHTGEKPYACPDCGKAFSHSSVLSTHQRIHTGERPYVCSDCGKAMSSKAQLSEH 549

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity