| Sequence 1: | NP_608840.1 | Gene: | CG15436 / 33657 | FlyBaseID: | FBgn0031610 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001075219.1 | Gene: | Zfp664 / 269704 | MGIID: | 2442505 | Length: | 261 | Species: | Mus musculus |
| Alignment Length: | 214 | Identity: | 86/214 - (40%) |
|---|---|---|---|
| Similarity: | 113/214 - (52%) | Gaps: | 0/214 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 127 ECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTF 191
Fly 192 AQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNH 256
Fly 257 FRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERT 321
Fly 322 FKCPHCASFYKQRKTLARH 340 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15436 | NP_608840.1 | zf-AD | 4..78 | CDD:285071 | |
| C2H2 Zn finger | 128..148 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 156..176 | CDD:275368 | 6/19 (32%) | ||
| COG5048 | <180..341 | CDD:227381 | 73/161 (45%) | ||
| C2H2 Zn finger | 184..204 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 197..219 | CDD:290200 | 12/21 (57%) | ||
| C2H2 Zn finger | 212..232 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 224..249 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 240..260 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 252..276 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 296..316 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 324..341 | CDD:275368 | 5/17 (29%) | ||
| Zfp664 | NP_001075219.1 | C2H2 Zn finger | 5..25 | CDD:275368 | |
| C2H2 Zn finger | 33..53 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 61..81 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 74..97 | CDD:404364 | 10/22 (45%) | ||
| C2H2 Zn finger | 89..109 | CDD:275368 | 9/19 (47%) | ||
| COG5048 | <94..256 | CDD:227381 | 68/152 (45%) | ||
| C2H2 Zn finger | 117..137 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 145..165 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 173..193 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 201..221 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 229..249 | CDD:275368 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||